- Description of Target:
- AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500
- Gene Symbol:
- ASCL2
- Official Gene Full Name:
- Achaete-scute complex homolog 2 (Drosophila)
- Alias Symbols:
- ASH2; HASH2; MASH2; bHLHa45
- Tissue Tool:
- Find tissues and cell lines supported to express ASCL2.
- Protein Accession# :
- NP_005161
- Nucleotide Accession#:
- NM_005170
- Swissprot Id:
- Q99929
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 193
- Molecular Weight:
- 20kDa
- Application:
- WB
- Partner Proteins:
- MT1G, AP1M1, AP1M1
- Immunogen:
- The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the middle region of human ASCL2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- ASCL2 antibody - middle region (ARP32025_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Mouse: 92%; Rat: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-ASCL2 antibody
- ARP32025_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
- Blocking Peptide:
- For anti-ASCL2 antibody is Catalog # AAP32025 (Previous Catalog # AAPP02926)
- Key Reference:
- Shahib,M.N., (2006) J Reprod Med 51 (11), 892-896
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-ASCL2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: ASCL2 antibody tested with Human Du145 Cells (ARP32025_P050)
Aviva Systems Biology is the original manufacturer of this ASCL2 antibody (ARP32025_P050)
Click here to view the ASCL2 antibody Western Blot Protocol
Product Datasheet Link: ASCL2 antibody (ARP32025_P050)
WB Suggested Anti-ASCL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: DU145
Western Blot image: 
Description of Target: AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s ASCL2 antibody (ARP32025_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
