website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

FOXM1 antibody - N-terminal region (ARP30772_P050)

Description of Target:
This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Gene Symbol:
Official Gene Full Name:
Forkhead box M1
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express FOXM1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Forkhead box protein M1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
FOXM1 antibody - N-terminal region (ARP30772_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-FOXM1 antibody
- ARP30772_P050
Peptide Sequence:
Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Blocking Peptide:
For anti-FOXM1 antibody is Catalog # AAP30772 (Previous Catalog # AAPP01435)
Additional Information:
IHC Information: Western analysis of Jurkat cell lysate.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for FOXM1 antibody (ARP30772)

Product page for FOXM1 antibody (ARP30772)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human FOXM1 antibody; Homo sapiens FOXM1 antibody Q08050 100%
Human FOXM1 antibody; Homo sapiens FOXM1 antibody Q08050-3 100%
Human FOXM1 antibody; Homo sapiens FOXM1 antibody Q08050-2 100%
Human FOXM1 antibody; Homo sapiens FOXM1 antibody Q53Y49 100%
Human FOXM1 antibody; Homo sapiens FOXM1 antibody A8K591 100%
Lowland gorilla FOXM1 antibody; Gorilla gorilla gorilla FOXM1 antibody G3SAZ9 100%
Lowland gorilla FOXM1 antibody; Gorilla gorilla gorilla FOXM1 antibody G3R1V7 100%
Northern white-cheeked gibbon FOXM1 antibody; Nomascus leucogenys FOXM1 antibody G1QRG2 93%
Northern white-cheeked gibbon FOXM1 antibody; Nomascus leucogenys FOXM1 antibody G1QRG0 93%
Northern white-cheeked gibbon FOXM1 antibody; Nomascus leucogenys FOXM1 antibody G1QRF9 93%
Rhesus macaque FOXM1 antibody; Macaca mulatta FOXM1 antibody F6T2H2 86%
Ask a Question