website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FOXM1 antibody - N-terminal region (ARP30772_P050)

Description of Target:
This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Gene Symbol:
FOXM1
Official Gene Full Name:
Forkhead box M1
NCBI Gene Id:
2305
Alias Symbols:
FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT
Tissue Tool:
Find tissues and cell lines supported to express FOXM1.
Protein Accession #:
NP_973731
Nucleotide Accession#:
NM_202002
Swissprot Id:
Q08050
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Forkhead box protein M1
Protein Size (# AA):
801
Molecular Weight:
88kDa
Application:
IHC, WB
Partner Proteins:
CDK1, CDK2, CREBBP, STAT3, CCNB1, CDH1, CENPF, CHEK2, ZBTB3
Immunogen:
The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FOXM1 antibody - N-terminal region (ARP30772_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-FOXM1 antibody
- ARP30772_P050
Peptide Sequence:
Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Blocking Peptide:
For anti-FOXM1 antibody is Catalog # AAP30772 (Previous Catalog # AAPP01435)
Additional Information:
IHC Information: Western analysis of Jurkat cell lysate.
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FOXM1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question