website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

FOXM1 antibody - N-terminal region (ARP30772_P050)

Description of Target:
This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Gene Symbol:
FOXM1
Official Gene Full Name:
Forkhead box M1
NCBI Gene Id:
2305
Alias Symbols:
FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXM1.
Swissprot Id:
Q08050
Protein Accession #:
NP_973731
Nucleotide Accession #:
NM_202002
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Forkhead box protein M1
Protein Size (# AA):
801
Molecular Weight:
88kDa
Application:
IHC, WB
Protein Interactions:
SMAD3; FZR1; SUMO1; UBE2I; SP1; CDK2; CCNE1; BANP; OS9; HSP90AA1; CDK6; CDK4; DHX29; ACAT1; CDC27; UBC; BCL6; SUMO2; RB1; CREBBP; CDC25B; CDK1; CCNB1; ZBTB3; CHEK2; STAT3; CDH1; CENPF;
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXM1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-FOXM1 (ARP30772_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for anti-FOXM1 (ARP30772_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Blocking Peptide:
For anti-FOXM1 (ARP30772_P050) antibody is Catalog # AAP30772 (Previous Catalog # AAPP01435)
Additional Information:
IHC Information: Western analysis of Jurkat cell lysate.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question