- Description of Target:
- Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Gene Symbol:
- CLDN7
- Official Gene Full Name:
- Claudin 7
- Alias Symbols:
- CEPTRL2; CPETRL2; Hs.84359; claudin-1; CLDN-7
- Tissue Tool:
- Find tissues and cell lines supported to express CLDN7.

- Protein Accession# :
- NP_001298
- Nucleotide Accession#:
- NM_001307
- Swissprot Id:
- O95471
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 211
- Molecular Weight:
- 22kDa
- Application:
- WB
- Partner Proteins:
- FOSL1, ATF1, BRCA1, CAMK1, CAMK2G, CREB1, CREBBP, CREM, CSNK2A1, CSNK2A2, EDF1, GABPA, GABPB1, HNF1B, JUN, PRKACA, RPS6KA4, RPS6KA5, SPI1, BRCA1, CAMK2A, CREBBP, CSNK2A1, CSNK2A2, CSNK2B, GABPA, HNF1B, SPI1
- Immunogen:
- The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the C terminal of human CLDN7
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CLDN7 antibody - C-terminal region (ARP31357_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 93%; Horse: 93%; Mouse: 93%; Rat: 93%; Sheep: 93%
- Datasheets / Downloads:
- Printable datasheet for
anti-CLDN7 antibody
- ARP31357_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
- Blocking Peptide:
- For anti-CLDN7 antibody is Catalog # AAP31357 (Previous Catalog # AAPP02112)
- Key Reference:
- Kleinberg,L., (2008) Hum. Pathol. 39 (5), 747-757
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CLDN7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CLDN7 antibody tested with Human Hela Cells (ARP31357_P050)
Aviva Systems Biology is the original manufacturer of this CLDN7 antibody (ARP31357_P050)
Click here to view the CLDN7 antibody Western Blot Protocol
Product Datasheet Link: CLDN7 antibody (ARP31357_P050)
WB Suggested Anti-CLDN7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela
Western Blot image: 
Description of Target: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CLDN7 antibody (ARP31357_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


