website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

VTN antibody - N-terminal region (ARP58095_P050)

Description of Target:
VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
VTN
Official Gene Full Name:
Vitronectin
NCBI Gene Id:
7448
Alias Symbols:
V75; VN; VNT
Sample Type Confirmation:

VTN is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VTN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VTN.
Swissprot Id:
P04004
Protein Accession #:
NP_000629
Nucleotide Accession #:
NM_000638
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Vitronectin
Protein Size (# AA):
478
Molecular Weight:
52kDa
Application:
WB
Protein Interactions:
GOPC; EED; ADH5; RHOXF1; ADTRP; ETV7; RPL13A; CBX1; PRDX4; CRADD; SIX1; GLUD1; CKS2; CD247; PRKCA; PRKACA; RBM25; WDR18; PRPF40A; SMU1; LUC7L3; SF3B6; HP1BP3; PRPF19; PHGDH; SF3B1; SF3B3; SRSF10; USP39; PRPF8; SF3A1; SAP18; HNRNPR; RBM39; SRSF11; BUD31; D
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human VTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-VTN (ARP58095_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for anti-VTN (ARP58095_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
Blocking Peptide:
For anti-VTN (ARP58095_P050) antibody is Catalog # AAP58095 (Previous Catalog # AAPP32528)
Target Reference:
Upton,Z., (2008) J. Invest. Dermatol. 128 (6), 1535-1544
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: VTN antibody tested with Human Hepg2 Cells (ARP58095_P050)

Aviva Systems Biology is the original manufacturer of this VTN antibody (ARP58095_P050)

Click here to view the VTN antibody Western Blot Protocol

Product Datasheet Link: VTN antibody (ARP58095_P050)

WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s VTN antibody (ARP58095_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question