website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

VTN antibody - N-terminal region (ARP58095_P050)

Description of Target:
VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
VTN
Official Gene Full Name:
Vitronectin
NCBI Gene Id:
7448
Alias Symbols:
V75; VN; VNT
Sample Type Confirmation:

VTN is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express VTN.
Protein Accession #:
NP_000629
Nucleotide Accession#:
NM_000638
Swissprot Id:
P04004
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Vitronectin
Protein Size (# AA):
478
Molecular Weight:
52kDa
Application:
WB
Partner Proteins:
ATP5J2, ATP5J2
Immunogen:
The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
VTN antibody - N-terminal region (ARP58095_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-VTN antibody
- ARP58095_P050
Peptide Sequence:
Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
Blocking Peptide:
For anti-VTN antibody is Catalog # AAP58095 (Previous Catalog # AAPP32528)
Key Reference:
Upton,Z., (2008) J. Invest. Dermatol. 128 (6), 1535-1544
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-VTN antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question