- Description of Target:
- VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Gene Symbol:
- VTN
- Official Gene Full Name:
- Vitronectin
- Alias Symbols:
- V75; VN; VNT
- Tissue Tool:
- Find tissues and cell lines supported to express VTN.
- Protein Accession# :
- NP_000629
- Nucleotide Accession#:
- NM_000638
- Swissprot Id:
- P04004
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 478
- Molecular Weight:
- 52kDa
- Application:
- WB
- Partner Proteins:
- ATP5J2, ATP5J2
- Immunogen:
- The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- VTN antibody - N-terminal region (ARP58095_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-VTN antibody
- ARP58095_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
- Blocking Peptide:
- For anti-VTN antibody is Catalog # AAP58095 (Previous Catalog # AAPP32528)
- Key Reference:
- Upton,Z., (2008) J. Invest. Dermatol. 128 (6), 1535-1544
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-VTN antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: VTN antibody tested with Human Hepg2 Cells (ARP58095_P050)
Aviva Systems Biology is the original manufacturer of this VTN antibody (ARP58095_P050)
Click here to view the VTN antibody Western Blot Protocol
Product Datasheet Link: VTN antibody (ARP58095_P050)
WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2
Western Blot image: 
Description of Target: VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s VTN antibody (ARP58095_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
