website statistics
Account Login 

Aviva Systems Biology office will be closed for Good Friday - 4/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

VTN antibody - N-terminal region (ARP58095_P050)

Description of Target:
VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
V75; VN; VNT
Sample Type Confirmation:

VTN is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express VTN.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
VTN antibody - N-terminal region (ARP58095_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-VTN antibody
- ARP58095_P050
Peptide Sequence:
Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
Blocking Peptide:
For anti-VTN antibody is Catalog # AAP58095 (Previous Catalog # AAPP32528)
Target Reference:
Upton,Z., (2008) J. Invest. Dermatol. 128 (6), 1535-1544
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for VTN antibody (ARP58095)

Product page for VTN antibody (ARP58095)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human VTN antibody; Homo sapiens VTN antibody F5GX75 100%
Human VTN antibody; Homo sapiens VTN antibody D9ZGG2 100%
Human VTNC antibody; Homo sapiens VTNC antibody P04004 100%
Lowland gorilla VTN antibody; Gorilla gorilla gorilla VTN antibody G3R679 100%
Northern white-cheeked gibbon VTN antibody; Nomascus leucogenys VTN antibody G1QNN4 92%
Rhesus macaque VTN antibody; Macaca mulatta VTN antibody F6SSW9 78%
Sumatran orangutan VTN antibody; Pongo abelii VTN antibody Q5NVS5 92%

Product Protocols: VTN antibody tested with Human Hepg2 Cells (ARP58095_P050)

Aviva Systems Biology is the original manufacturer of this VTN antibody (ARP58095_P050)

Click here to view the VTN antibody Western Blot Protocol

Product Datasheet Link: VTN antibody (ARP58095_P050)

WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:

Description of Target: VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s VTN antibody (ARP58095_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question