website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TRAF6 antibody - middle region (ARP30226_P050)

Receive a free positive control (AHL005) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TRAF6 is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein.The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported.
Gene Symbol:
Official Gene Full Name:
TNF receptor-associated factor 6, E3 ubiquitin protein ligase
NCBI Gene Id:
Alias Symbols:
MGC:3310; RNF85
Tissue Tool:
Find tissues and cell lines supported to express TRAF6.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
TNF receptor-associated factor 6
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TRAF6 antibody - middle region (ARP30226_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Pig, Rat, Horse, Rabbit, Mouse, Bovine, Human
Datasheets / Downloads:
Printable datasheet for
anti-TRAF6 antibody
- ARP30226_P050
Peptide Sequence:
Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Blocking Peptide:
For anti-TRAF6 antibody is Catalog # AAP30226 (Previous Catalog # AAPS09104)
Key Reference:
Jazdzewski,K., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (20), 7269-7274
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TRAF6 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question