website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TRAF6 antibody - middle region (ARP30226_P050)

Receive a free positive control (AHL005) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TRAF6 is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein.The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported.
Gene Symbol:
TRAF6
Official Gene Full Name:
TNF receptor-associated factor 6, E3 ubiquitin protein ligase
NCBI Gene Id:
7189
Alias Symbols:
MGC:3310; RNF85
Tissue Tool:
Find tissues and cell lines supported to express TRAF6.
Protein Accession #:
NP_004611
Nucleotide Accession#:
NM_004620
Swissprot Id:
Q9Y4K3
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
TNF receptor-associated factor 6
Protein Size (# AA):
522
Molecular Weight:
59kDa
Application:
WB
Partner Proteins:
CSNK2B, SUB1, BLM, TERF2IP, TINF2, WRN, BLM, TERF2, TERF2IP, TINF2, WRN, XRCC6, BLM, BTBD12, DCLRE1B, MRE11A, NBN, ORC1L, ORC2L, ORC3L, ORC6L, RAD50, TERF2IP, TINF2, WRN, XRCC5, XRCC6
Immunogen:
The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TRAF6 antibody - middle region (ARP30226_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Pig, Rat, Horse, Rabbit, Mouse, Bovine, Human
Datasheets / Downloads:
Printable datasheet for
anti-TRAF6 antibody
- ARP30226_P050
Peptide Sequence:
Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Blocking Peptide:
For anti-TRAF6 antibody is Catalog # AAP30226 (Previous Catalog # AAPS09104)
Target Reference:
Jazdzewski,K., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (20), 7269-7274
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TRAF6 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for TRAF6 antibody (ARP30226)

Product page for TRAF6 antibody (ARP30226)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant TRAF6 antibody; Loxodonta africana TRAF6 antibody G3TWA4 90%
African elephant TRAF6 antibody; Loxodonta africana TRAF6 antibody G3TH24 90%
Bovine TRAF6 antibody; Bos taurus TRAF6 antibody Q3ZCC3 100%
Bovine TRAF6 antibody; Bos taurus TRAF6 antibody Q1KLV9 100%
Dog TRAF6 antibody; Canis familiaris TRAF6 antibody E2RDE8 100%
Duckbill platypus LOC100077058 antibody; Ornithorhynchus anatinus LOC100077058 antibody F6S636 100%
Duckbill platypus TRAF6 antibody; Ornithorhynchus anatinus TRAF6 antibody F6S627 100%
Giant panda LOC100483216 antibody; Ailuropoda melanoleuca LOC100483216 antibody G1M5H7 100%
Gray short-tailed opossum TRAF6 antibody; Monodelphis domestica TRAF6 antibody F6SAI1 100%
Horse TRAF6 antibody; Equus caballus TRAF6 antibody F6URD5 100%
Human TRAF6 antibody; Homo sapiens TRAF6 antibody Q9Y4K3 100%
Little brown bat TRAF6 antibody; Myotis lucifugus TRAF6 antibody G1P0K0 100%
Lowland gorilla TRAF6 antibody; Gorilla gorilla gorilla TRAF6 antibody G3RZE6 100%
Lowland gorilla TRAF6 antibody; Gorilla gorilla gorilla TRAF6 antibody G3QST5 100%
Mouse TRAF6 antibody; Mus musculus TRAF6 antibody P70196 100%
Northern white-cheeked gibbon TRAF6 antibody; Nomascus leucogenys TRAF6 antibody G1S8G6 100%
Pig TRAF6 antibody; Sus scrofa TRAF6 antibody A7XUJ6 100%
Pig TRAF6 antibody; Sus scrofa TRAF6 antibody F1SHG5 100%
Rabbit TRAF6 antibody; Oryctolagus cuniculus TRAF6 antibody G1T2F3 100%
Rat TRAF6 antibody; Rattus norvegicus TRAF6 antibody B5DF45 100%
Rhesus macaque Mmu.17706 antibody; Macaca mulatta Mmu.17706 antibody F7HMD7 100%
Rhesus macaque Mmu.17706 antibody; Macaca mulatta Mmu.17706 antibody F6W158 100%
Rhesus macaque TRAF6 antibody; Macaca mulatta TRAF6 antibody B6CJY5 100%
Small-eared galago TRAF6 antibody; Otolemur garnettii TRAF6 antibody H0WWF3 100%
Sooty mangabey TRAF6 antibody; Cercocebus atys TRAF6 antibody B6CJY4 100%
Tasmanian devil TRAF6 antibody; Sarcophilus harrisii TRAF6 antibody G3WLM2 100%
White-tufted-ear marmoset TRAF6 antibody; Callithrix jacchus TRAF6 antibody F7ES31 100%
Zebra finch TRAF6 antibody; Taeniopygia guttata TRAF6 antibody H0ZIP5 100%

Product Protocols: TRAF6 antibody tested with Human 293T Cells (ARP30226_P050)

Aviva Systems Biology is the original manufacturer of this TRAF6 antibody (ARP30226_P050)

Click here to view the TRAF6 antibody Western Blot Protocol

Product Datasheet Link: TRAF6 antibody (ARP30226_P050)

WB Suggested Anti-TRAF6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T

Western Blot image:


Description of Target: TRAF6 is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein.The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TRAF6 antibody (ARP30226_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question