RGS4 antibody - C-terminal region (ARP30354_P050)

Catalog#: ARP30354_P050

• Size: 50ug

Human HepG2

• Description of Target: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.
• Gene Symbol: RGS4
• Official Gene Full Name: Regulator of G-protein signaling 4
• Alias Symbols: DKFZp761F1924; MGC2124; MGC60244; RGP4; SCZD9
• Protein Accession#: NP_001095915
• Nucleotide Accession#: NM_001102445
• Swissprot Id: A7XA59
• Host: Rabbit
• Protein Size (# AA): 302
• Molecular Weight: 34kDa
• Application: WB
• Partner Proteins: CALM1,COPB1,COPB2,ERBB3,GNAI1,GNAI2,GNAO1,GNAQ,PLCB1,PTAFR,COPB2,ERBB3,GNAI1,GNAI1,GNAI2,GNAI2,GNAI3,GNAO1,GNAQ,GNAQ,GNAT1
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: IFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
• Blocking Peptide: For anti-RGS4 antibody is Catalog # AAP30354
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-RGS4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.