website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

GPX4 antibody - middle region (ARP58473_P050)

Description of Target:
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Gene Symbol:
GPX4
Official Gene Full Name:
Glutathione peroxidase 4
NCBI Gene Id:
2879
Alias Symbols:
MCSP; PHGPx; snGPx; snPHGPx
Sample Type Confirmation:

GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express GPX4.
Protein Accession #:
NP_002076
Nucleotide Accession#:
NM_002085
Swissprot Id:
P36969
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Protein Size (# AA):
197
Molecular Weight:
22kDa
Application:
IHC, WB
Partner Proteins:
CRMP1, HNRNPF, NCBP1, NCBP2, NDRG1, SFRS12, SUMO4, TCERG1, TOM1L1, YWHAG, CCT4, CCT5, CDK9, CPNE1, CRMP1, DDX17, DDX5, GPN1, HNRNPA1, HNRNPA2B1, HNRNPD, HNRNPF, HNRNPH2, HNRNPK, HNRNPM, HNRNPU, HSPD1, KHDRBS2, KHSRP, KPNA2, MEPCE, NCBP1, NCBP2, RQCD1, SYNCRIP, TCERG1, YKT6, YTHDF2
Immunogen:
The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
GPX4 antibody - middle region (ARP58473_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Yeast: 93%; Pig: 86%; Rat: 86%; Goat: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%; Guinea pig: 86%
Species Reactivity:
Human, Yeast, Rat, Zebrafish, Goat, Mouse, Guinea pig, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-GPX4 antibody
- ARP58473_P050
Peptide Sequence:
Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Blocking Peptide:
For anti-GPX4 antibody is Catalog # AAP58473 (Previous Catalog # AAPP34569)
Additional Information:
IHC Information: Human Testis (formalin-fixed, paraffin-embedded) stained with GPX4 antibody ARP58473_P050 at 2.5 ug/ml followed by biotinylated anti-goat IgG secondary antibody LS-D3, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Heart
Key Reference:
Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-GPX4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question