website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GPX4 antibody - middle region (ARP58473_P050)

Description of Target:
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Gene Symbol:
Official Gene Full Name:
Glutathione peroxidase 4
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express GPX4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
GPX4 antibody - middle region (ARP58473_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Yeast: 93%; Pig: 86%; Rat: 86%; Goat: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%; Guinea pig: 86%
Species Reactivity:
Human, Yeast, Rat, Zebrafish, Goat, Mouse, Guinea pig, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-GPX4 antibody
- ARP58473_P050
Peptide Sequence:
Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Blocking Peptide:
For anti-GPX4 antibody is Catalog # AAP58473 (Previous Catalog # AAPP34569)
Additional Information:
IHC Information: Human Testis (formalin-fixed, paraffin-embedded) stained with GPX4 antibody ARP58473_P050 at 2.5 ug/ml followed by biotinylated anti-goat IgG secondary antibody LS-D3, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Heart
Target Reference:
Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GPX4 antibody (ARP58473)

Product page for GPX4 antibody (ARP58473)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant GPX3 antibody; Loxodonta africana GPX3 antibody G3TLJ5 85%
African elephant GPX6 antibody; Loxodonta africana GPX6 antibody G3TFW5 85%
African elephant LOC100664315 antibody; Loxodonta africana LOC100664315 antibody G3TFW7 85%
Alfalfa GPX antibody; Medicago sativa GPX antibody Q05FZ6 92%
Barley BarPHGPX antibody; Hordeum vulgare BarPHGPX antibody Q852R3 85%
Bitter gourd PHGPX antibody; Momordica charantia PHGPX antibody Q8W259 78%
blue catfish GPX4 antibody; Ictalurus furcatus GPX4 antibody E3TCT3 78%
Bornean orangutan GPX3 antibody; Pongo pygmaeus GPX3 antibody Q5RFG3 85%
Bornean orangutan GPX4 antibody; Pongo pygmaeus GPX4 antibody Q4AEH2 100%
Bornean orangutan GPX4 antibody; Pongo pygmaeus GPX4 antibody Q4AEH2-2 100%
Bovine GPX3 antibody; Bos taurus GPX3 antibody P37141 85%
Bovine GPX3 antibody; Bos taurus GPX3 antibody G3X8D7 85%
Bovine GPX4 antibody; Bos taurus GPX4 antibody Q9N2J2 85%
Bovine GPX4 antibody; Bos taurus GPX4 antibody Q9N2J2-2 85%
Bovine GPX5 antibody; Bos taurus GPX5 antibody G3N2N9 85%
Brown-capped capuchin GPX3 antibody; Cebus apella GPX3 antibody Q4AEH3 85%
Brown-capped capuchin GPX4 antibody; Cebus apella GPX4 antibody Q4AEG9 100%
Brown-capped capuchin GPX4 antibody; Cebus apella GPX4 antibody Q4AEG9-2 100%
Common gibbon GPX3 antibody; Hylobates lar GPX3 antibody Q4AEH5 85%
Common gibbon GPX4 antibody; Hylobates lar GPX4 antibody Q4AEH1 100%
Common gibbon GPX4 antibody; Hylobates lar GPX4 antibody Q4AEH1-2 100%
Common plantain gpx1 antibody; Plantago major gpx1 antibody Q2YHN3 92%
Common sunflower GPX1 antibody; Helianthus annuus GPX1 antibody O23970 85%
Common sunflower GPX4 antibody; Helianthus annuus GPX4 antibody O23968 92%
Crab-eating macaque GPX5 antibody; Macaca fascicularis GPX5 antibody P28714 85%
Duckbill platypus 100078236 antibody; Ornithorhynchus anatinus 100078236 antibody F7BBX1 85%
Duckbill platypus 100078236 antibody; Ornithorhynchus anatinus 100078236 antibody F7BBW2 85%
Garden pea GPX1 antibody; Pisum sativum GPX1 antibody O24296 92%
Giant panda GPX3 antibody; Ailuropoda melanoleuca GPX3 antibody G1LNY7 85%
Giant panda GPX6 antibody; Ailuropoda melanoleuca GPX6 antibody G1M5M4 85%
Giant panda LOC100473987 antibody; Ailuropoda melanoleuca LOC100473987 antibody G1M5L7 85%
Goat GPx4 antibody; Capra hircus GPx4 antibody C7EXB8 85%
Green alga gpx2 antibody; Volvox carteri gpx2 antibody D8TLV1 85%
Guinea pig GP-GPx4 antibody; Cavia porcellus GP-GPx4 antibody Q9JHM1 85%
Guinea pig GPX3 antibody; Cavia porcellus GPX3 antibody H0V867 85%
Guinea pig GPX5 antibody; Cavia porcellus GPX5 antibody H0UZ56 85%
Horse GPX6 antibody; Equus caballus GPX6 antibody F7CPY6 85%
Human GPX3 antibody; Homo sapiens GPX3 antibody P22352 85%
Human GPX4 antibody; Homo sapiens GPX4 antibody P36969 100%
Human GPX4 antibody; Homo sapiens GPX4 antibody P36969-2 100%
Human GPX4 antibody; Homo sapiens GPX4 antibody Q6PI42 100%
Human GPX5 antibody; Homo sapiens GPX5 antibody O75715 85%
Human GPX6 antibody; Homo sapiens GPX6 antibody P59796 85%
Human GPX6 antibody; Homo sapiens GPX6 antibody E7ERK5 85%
Japanese macaque GPX3 antibody; Macaca fuscata fuscata GPX3 antibody Q4AEH4 85%
Japanese macaque GPX4 antibody; Macaca fuscata fuscata GPX4 antibody Q4AEH0 100%
Japanese macaque GPX4 antibody; Macaca fuscata fuscata GPX4 antibody Q4AEH0-2 100%
Lima bean GP1 antibody; Phaseolus lunatus GP1 antibody Q4ZJ67 85%
Little brown bat GPX3 antibody; Myotis lucifugus GPX3 antibody G1PDD1 85%
Lowland gorilla GPX3 antibody; Gorilla gorilla gorilla GPX3 antibody G3S1T7 85%
Lowland gorilla GPX3 antibody; Gorilla gorilla gorilla GPX3 antibody G3QF14 85%
Lowland gorilla GPX4 antibody; Gorilla gorilla gorilla GPX4 antibody G3R6N4 100%
Lowland gorilla GPX5 antibody; Gorilla gorilla gorilla GPX5 antibody G3RSH4 85%
Lowland gorilla GPX5 antibody; Gorilla gorilla gorilla GPX5 antibody G3QVI2 85%
Lowland gorilla GPX5 antibody; Gorilla gorilla gorilla GPX5 antibody G3QCZ4 85%
Maize GP antibody; Zea mays GP antibody Q8LK64 85%
Maize LOC100273297 antibody; Zea mays LOC100273297 antibody Q6JAH6 85%
Maize LOC100280060 antibody; Zea mays LOC100280060 antibody B8A1P1 85%
Maize LOC100281291 antibody; Zea mays LOC100281291 antibody B6SU31 85%
Mango POD antibody; Mangifera indica POD antibody D2XZ12 85%
Mouse Gpx4 antibody; Mus musculus Gpx4 antibody Q76LV0 85%
Mouse Gpx4 antibody; Mus musculus Gpx4 antibody Q5XJZ8 85%
Mouse Gpx4 antibody; Mus musculus Gpx4 antibody Q3TIF2 85%
Mouse Gpx4 antibody; Mus musculus Gpx4 antibody Q3TI34 85%
Mouse GPX41 antibody; Mus musculus GPX41 antibody O70325 85%
Mouse GPX41 antibody; Mus musculus GPX41 antibody O70325-2 85%
Mouse GPX42 antibody; Mus musculus GPX42 antibody Q91XR9 85%
Mouse GPX6 antibody; Mus musculus GPX6 antibody Q91WR8 85%
Mouse Gpx6 antibody; Mus musculus Gpx6 antibody F2Z3U8 85%
Mouse Hnrpll antibody; Mus musculus Hnrpll antibody Q8K4U7 85%
Mouse-ear cress GPX6 antibody; Arabidopsis thaliana GPX6 antibody O48646 85%
Northern white-cheeked gibbon GPX3 antibody; Nomascus leucogenys GPX3 antibody G1RHU5 85%
Northern white-cheeked gibbon GPX4 antibody; Nomascus leucogenys GPX4 antibody G1QKS7 100%
Northern white-cheeked gibbon GPX4 antibody; Nomascus leucogenys GPX4 antibody G1QKS4 100%
Northern white-cheeked gibbon LOC100579636 antibody; Nomascus leucogenys LOC100579636 antibody G1QX84 85%
Picoplanktonic green alga GPX5 antibody; Micromonas pusilla GPX5 antibody C1MP63 92%
Pig GPX3 antibody; Sus scrofa GPX3 antibody Q6UJZ1 85%
Pig GPX5 antibody; Sus scrofa GPX5 antibody O18994 85%
Rabbit GPX6 antibody; Oryctolagus cuniculus GPX6 antibody G1TCG2 85%
Rat GPX3 antibody; Rattus norvegicus GPX3 antibody P23764 85%
Rat Gpx3 antibody; Rattus norvegicus Gpx3 antibody F1LPZ5 85%
Rat Gpx4 antibody; Rattus norvegicus Gpx4 antibody Q76LU9 85%
Rat Gpx4 antibody; Rattus norvegicus Gpx4 antibody F8WFK6 85%
Rat GPX41 antibody; Rattus norvegicus GPX41 antibody P36970 85%
Rat GPX41 antibody; Rattus norvegicus GPX41 antibody P36970-2 85%
Rat GPX42 antibody; Rattus norvegicus GPX42 antibody Q91XR8 85%
Rat GPX6 antibody; Rattus norvegicus GPX6 antibody Q64625 85%
Rhesus macaque GPX6 antibody; Macaca mulatta GPX6 antibody F6Q080 85%
Rice GPX1 antibody; Oryza sativa GPX1 antibody Q8L8G3 92%
Rice Os02g0664000 antibody; Oryza sativa subsp. japonica Os02g0664000 antibody Q6ESJ0 85%
Rice Os04g0556300 antibody; Oryza sativa subsp. japonica Os04g0556300 antibody Q0JB49 92%
Rice Os11g0284900 antibody; Oryza sativa subsp. japonica Os11g0284900 antibody Q0ITA3 85%
Rice OSJNBb0012E24.9 antibody; Oryza sativa subsp. japonica OSJNBb0012E24.9 antibody Q7XU04 92%
Salt cress GPX6 antibody; Thellungiella halophila GPX6 antibody D0PWB6 92%
Small-eared galago GPX5 antibody; Otolemur garnettii GPX5 antibody H0WUJ7 85%
Sorghum Sb04g032520 antibody; Sorghum bicolor Sb04g032520 antibody C5Y1E9 85%
Sorghum Sb06g024920 antibody; Sorghum bicolor Sb06g024920 antibody Q6JAG4 85%
Soybean LOC100305775 antibody; Glycine max LOC100305775 antibody C6SWL0 85%
Soybean LOC100306570 antibody; Glycine max LOC100306570 antibody C6SZX7 85%
Soybean LOC100500036 antibody; Glycine max LOC100500036 antibody C6SZK3 85%
Soybean LOC100527421 antibody; Glycine max LOC100527421 antibody C6T4A1 85%
Spinach GPX4 antibody; Spinacia oleracea GPX4 antibody O23814 92%
strain 972 / ATCC 24843 GPX1 antibody; Schizosaccharomyces pombe GPX1 antibody O59858 85%
strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100 bsaA antibody; Bdellovibrio bacteriovorus bsaA antibody Q6MQE8 92%
strain ATCC 204508 / S288c GPX2 antibody; Saccharomyces cerevisiae GPX2 antibody P38143 85%
strain ATCC 204508 / S288c GPX3 antibody; Saccharomyces cerevisiae GPX3 antibody P40581 85%
strain ATCC 35852 / DSM 46488 / JCM 4925 / NBRC 14057 / NRRL 8057 btuE antibody; Streptomyces cattleya btuE antibody F8JXQ5 85%
strain ATCC BAA-682 / DSM 15412 / SJ gpo antibody; Bacteriovorax marinus gpo antibody E1X5Q7 92%
strain JAY291 GPX2 antibody; Saccharomyces cerevisiae GPX2 antibody C7GMY7 85%
strain JAY291 HYR1 antibody; Saccharomyces cerevisiae HYR1 antibody C7GLR9 85%
strain Kyokai no. 7 / NBRC 101557 K7_GPX2 antibody; Saccharomyces cerevisiae K7_GPX2 antibody G2W9P7 85%
strain Kyokai no. 7 / NBRC 101557 K7_HYR1 antibody; Saccharomyces cerevisiae K7_HYR1 antibody G2WFW5 85%
strain Po82 btuE antibody; Ralstonia solanacearum btuE antibody F6FYP4 85%
strain SC5314 / ATCC MYA-2876 GPS1 antibody; Candida albicans GPS1 antibody Q59WW8 85%
strain SC5314 / ATCC MYA-2876 GPS2 antibody; Candida albicans GPS2 antibody Q59WW7 92%
strain YJM789 GPX2 antibody; Saccharomyces cerevisiae GPX2 antibody A6ZLI3 85%
strain YJM789 HYR1 antibody; Saccharomyces cerevisiae HYR1 antibody A6ZVV7 85%
Tasmanian devil GPX4 antibody; Sarcophilus harrisii GPX4 antibody G3WAH0 85%
Western balsam poplar PtrcGpx2_1 antibody; Populus trichocarpa PtrcGpx2_1 antibody B9HH74 85%
Western balsam poplar PtrcGpx3_2 antibody; Populus trichocarpa PtrcGpx3_2 antibody B9GWH5 85%
White-tufted-ear marmoset GPX3 antibody; Callithrix jacchus GPX3 antibody F7IQI5 85%
White-tufted-ear marmoset GPX4 antibody; Callithrix jacchus GPX4 antibody Q32QL6 100%
White-tufted-ear marmoset GPX4 antibody; Callithrix jacchus GPX4 antibody Q32QL6-2 100%
White-tufted-ear marmoset LOC100397964 antibody; Callithrix jacchus LOC100397964 antibody F7I3U2 85%
White-tufted-ear marmoset LOC100408129 antibody; Callithrix jacchus LOC100408129 antibody F7IAU4 85%
Yeast TDEL0A04230 antibody; Torulaspora delbrueckii TDEL0A04230 antibody G8ZMB1 85%
Yeast TDEL0B03940 antibody; Torulaspora delbrueckii TDEL0B03940 antibody G8ZPH9 85%
Yellowfever mosquito GPx antibody; Aedes aegypti GPx antibody Q5K6H6 85%
Zebrafish gpx4b antibody; Danio rerio gpx4b antibody Q802G1 85%
Zebrafish gpx4b antibody; Danio rerio gpx4b antibody Q503Y1 85%
Zebrafish gpx4b antibody; Danio rerio gpx4b antibody C3S171 85%

Product Review: GPX4 antibody – middle region (ARP58473_P050) in rat dorsal medulla brain using western blot

Product Page for GPX4 antibody - middle region (ARP58473_P050)

Researcher: Manisha Nautiyal, Hypertension and Vascular Research Center, Wake Forest University School of Medicine
Application: Western blotting
Species+tissue/cell type: Rat dorsal medulla brain
How many ug’s of tissue/cell lysate run on the gel: 1. 40ug rat dorsal medulla brain extract
Primary antibody dilution: 1:2000
Secondary antibody: Anti-Rabbit HRP
Secondary antibody dilution: 1:5000


How do Aviva’s reagents play a role in your experimental goals?

To determine oxidative stress status in our animal models.

How would you rate this antibody on a scale from 1-5 (5=best) and why?

5- clean band at expected MW.

Would you use this antibody in future experiments?


Have you used another antibody which has worked in your application?


If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?


Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

Rat brain: lane #1 is dorsal medulla tissue extract (40 ug) .

How many different experimental trials were conducted using the antibody sample?


What type of experimental sample are you using and how did you preparing it?

Lane # 1: homogenize brain dorsal medulla in 20mM potassium phosphate buffer, pH 7.0 with 1mM EGTA and Sigma protease cocktail inhibitor; and prepare samples in Laemmli buffer for WB.

Primary used and dilution:

1: 2000 in 5% milk-TBST (0.05% Tween) for overnight at 4 degrees.

Secondary used and dilution:

1: 5000 anti-Rabbit HRP in 5% milk-TBST for 2 hrs at room temperature.

Experimental Procedure/Protocols:

"Gels: (cat#161-1155, BioRad) Ready Gel Tris-HCl Gel, 10% resolving gel, 4% stacking gel, 10-well, 50 µl,

Running buffer: BioRad cat #  161-0732   : 1X Tris/Glycine/SDS: run gels for 70 min at 120 V

Transfer buffer: BioRad cat #  161-0734   : 1X Tris/Glycine with 20% methanol: Transfer for 1 hr at 100V

Blocking buffer: 5% milk in TBS-Tween (0.05%) for 1 hr at room temperature

Primary antibody: overnight at 4 degrees

Wash 3 times with TBST for 10 min per wash

Secondary antibody: 2 hrs room temperature

Wash 3 times wiht TBST for 10 min per wash

Develop bands with chemiluminescent substrate (Pierce: SuperSignal West Pico Chemiluminescent Substrate)"

What controls were used in your experiment? Please include your positive control:

Tissue (positive).

How did you store the antibody after re-suspension?

In water, at -80 degrees.

Ask a Question