- Description of Target:
- The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition. GLP2R, a G protein-coupled receptor superfamily member is expressed in the gut and closely related to the glucagon receptor (GCGR) and the receptor for GLP1 (GLP1R). The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition. GLP2R, a G protein-coupled receptor superfamily member is expressed in the gut and closely related to the glucagon receptor (GCGR) and the receptor for GLP1 (GLP1R).
- Gene Symbol:
- GLP2R
- Official Gene Full Name:
- Glucagon-like peptide 2 receptor
- Alias Symbols:
- -
- Tissue Tool:
- Find tissues and cell lines supported to express GLP2R.
- Protein Accession# :
- NP_004237
- Nucleotide Accession#:
- NM_004246
- Swissprot Id:
- O95838
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 553
- Molecular Weight:
- 61kDa
- Application:
- WB
- Partner Proteins:
- TTC1, ADRB2, CHRM2, CNR1, CNR2, CXCR1, CXCR2, F2R, GRM2, GRM4, HRH4, LTB4R, OPRD1, OPRK1, OPRM1, PRKCA, RGS2, TTC1, ADRBK1, RGS2, TTC1
- Immunogen:
- The immunogen for anti-GLP2R antibody: synthetic peptide directed towards the N terminal of human GLP2R
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- GLP2R antibody - N-terminal region (ARP58471_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-GLP2R antibody
- ARP58471_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP
- Blocking Peptide:
- For anti-GLP2R antibody is Catalog # AAP58471 (Previous Catalog # AAPP34521)
- Key Reference:
- Sams,A., Eur. J. Pharmacol. 532 (1-2), 18-23 (2006)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-GLP2R antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: GLP2R antibody tested with Human Hepg2 Cells (ARP58471_P050)
Aviva Systems Biology is the original manufacturer of this GLP2R antibody (ARP58471_P050)
Click here to view the GLP2R antibody Western Blot Protocol
Product Datasheet Link: GLP2R antibody (ARP58471_P050)
WB Suggested Anti-GLP2R Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2
Western Blot image: 
Description of Target: The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition. GLP2R, a G protein-coupled receptor superfamily member is expressed in the gut and closely related to the glucagon receptor (GCGR) and the receptor for GLP1 (GLP1R). The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition. GLP2R, a G protein-coupled receptor superfamily member is expressed in the gut and closely related to the glucagon receptor (GCGR) and the receptor for GLP1 (GLP1R).
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s GLP2R antibody (ARP58471_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
