website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Foxo4 antibody - C-terminal region (ARP38710_P050)

Description of Target:
Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Gene Symbol:
Official Gene Full Name:
Forkhead box O4
NCBI Gene Id:
Alias Symbols:
Afxh; MGC117660; Mllt7; afx
Tissue Tool:
Find tissues and cell lines supported to express Foxo4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Histone acetyltransferase KAT5
Protein Size (# AA):
Molecular Weight:
Product Format:
Lyophilized powder
Complete computational species homology data:
Foxo4 antibody - C-terminal region (ARP38710_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Species Reactivity:
Mouse, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Human, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-Foxo4 antibody
- ARP38710_P050
Peptide Sequence:
Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
Blocking Peptide:
For anti-Foxo4 antibody is Catalog # AAP38710
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Foxo4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Foxo4 antibody (ARP38710)

Product page for Foxo4 antibody (ARP38710)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant FOXO4 antibody; Loxodonta africana FOXO4 antibody G3UCT4 100%
Bovine FOXO4 antibody; Bos taurus FOXO4 antibody A6QLP0 92%
Chicken FOXO4 antibody; Gallus gallus FOXO4 antibody F1NGG3 91%
Chinese hamster Foxo4 antibody; Cricetulus griseus Foxo4 antibody G3I7K4 100%
Common turkey FOXO4 antibody; Meleagris gallopavo FOXO4 antibody G1MTJ4 91%
Dog FOXO4 antibody; Canis familiaris FOXO4 antibody E2RTA1 100%
Giant panda FOXO4 antibody; Ailuropoda melanoleuca FOXO4 antibody G1MBP3 100%
Gray short-tailed opossum FOXO4 antibody; Monodelphis domestica FOXO4 antibody F7FKI3 85%
Guinea pig FOXO4 antibody; Cavia porcellus FOXO4 antibody H0V3X2 100%
Horse FOXO4 antibody; Equus caballus FOXO4 antibody F7DRE4 100%
Human FOXO4 antibody; Homo sapiens FOXO4 antibody P98177 100%
Human FOXO4 antibody; Homo sapiens FOXO4 antibody P98177-2 100%
Little brown bat FOXO4 antibody; Myotis lucifugus FOXO4 antibody G1Q0C6 92%
Lowland gorilla FOXO4 antibody; Gorilla gorilla gorilla FOXO4 antibody G3QHF7 100%
Mouse FOXO4 antibody; Mus musculus FOXO4 antibody Q9WVH3 100%
Mouse Foxo4 antibody; Mus musculus Foxo4 antibody B1AUT3 100%
Mouse Foxo4 antibody; Mus musculus Foxo4 antibody B1AUT2 100%
Northern white-cheeked gibbon FOXO4 antibody; Nomascus leucogenys FOXO4 antibody G1QK78 92%
Pig FOXO4 antibody; Sus scrofa FOXO4 antibody F1RSV5 100%
Rabbit FOXO4 antibody; Oryctolagus cuniculus FOXO4 antibody G1TFI8 100%
Rat Foxo4 antibody; Rattus norvegicus Foxo4 antibody D4A433 100%
Rat Foxo4 antibody; Rattus norvegicus Foxo4 antibody D3Z911 100%
Rhesus macaque FOXO4 antibody; Macaca mulatta FOXO4 antibody F6UBP4 100%
Small-eared galago FOXO4 antibody; Otolemur garnettii FOXO4 antibody H0XWK9 100%
Tasmanian devil FOXO4 antibody; Sarcophilus harrisii FOXO4 antibody G3VM37 83%
White-tufted-ear marmoset FOXO4 antibody; Callithrix jacchus FOXO4 antibody F6UYC2 100%
Zebra finch FOXO4 antibody; Taeniopygia guttata FOXO4 antibody H0ZA91 85%
Ask a Question