website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Foxo4 antibody - C-terminal region (ARP38710_P050)

Description of Target:
Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Gene Symbol:
Foxo4
Official Gene Full Name:
Forkhead box O4
NCBI Gene Id:
54601
Alias Symbols:
Afxh; MGC117660; Mllt7; afx
Tissue Tool:
Find tissues and cell lines supported to express Foxo4.
Protein Accession #:
NP_001005872
Nucleotide Accession#:
NM_001005872
Swissprot Id:
Q99MK2
Host:
Rabbit
Protein Name:
Histone acetyltransferase KAT5
Protein Size (# AA):
505
Molecular Weight:
54kDa
Application:
WB
Product Format:
Lyophilized powder
Complete computational species homology data:
Foxo4 antibody - C-terminal region (ARP38710_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Species Reactivity:
Mouse, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Human, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-Foxo4 antibody
- ARP38710_P050
Peptide Sequence:
Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
Blocking Peptide:
For anti-Foxo4 antibody is Catalog # AAP38710
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Foxo4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question