website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

Foxo4 antibody - C-terminal region (ARP38710_P050)

Description of Target:
Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Gene Symbol:
Foxo4
Official Gene Full Name:
Forkhead box O4
NCBI Gene Id:
54601
Alias Symbols:
Afxh; MGC117660; Mllt7; afx
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Foxo4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Foxo4.
Swissprot Id:
Q99MK2
Protein Accession #:
NP_001005872
Nucleotide Accession #:
NM_001005872
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Histone acetyltransferase KAT5
Protein Size (# AA):
505
Molecular Weight:
54kDa
Application:
WB
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Foxo4 antibody - C-terminal region (ARP38710_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Species Reactivity:
Mouse, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Human, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-Foxo4 antibody
- ARP38710_P050
Peptide Sequence:
Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
Blocking Peptide:
For anti-Foxo4 antibody is Catalog # AAP38710
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question