website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

DFFA antibody - N-terminal region (ARP30359_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
DNA fragmentation factor, 45kDa, alpha polypeptide
NCBI Gene Id:
Alias Symbols:
DFF-45; DFF1; Ion ChannelAD; ICAD
Tissue Tool:
Find tissues and cell lines supported to express DFFA.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
DNA fragmentation factor subunit alpha
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-DFFA antibody: synthetic peptide directed towards the N terminal of human DFFA
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
DFFA antibody - N-terminal region (ARP30359_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 83%; Mouse: 83%
Species Reactivity:
Human, Horse, Guinea pig, Bovine, Rat, Dog, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-DFFA antibody
- ARP30359_T100
Peptide Sequence:
Synthetic peptide located within the following region: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDIL
Blocking Peptide:
For anti-DFFA antibody is Catalog # AAP30359 (Previous Catalog # AAPS08806)
Key Reference:
Yan,B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1504-1509
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-DFFA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question