website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

DFFA antibody - N-terminal region (ARP30359_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
DNA fragmentation factor, 45kDa, alpha polypeptide
NCBI Gene Id:
Alias Symbols:
DFF-45; DFF1; Ion ChannelAD; ICAD
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DFFA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DFFA.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
DNA fragmentation factor subunit alpha
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-DFFA antibody: synthetic peptide directed towards the N terminal of human DFFA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
DFFA antibody - N-terminal region (ARP30359_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 83%; Mouse: 83%
Species Reactivity:
Human, Horse, Guinea pig, Bovine, Rat, Dog, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-DFFA antibody
- ARP30359_T100
Peptide Sequence:
Synthetic peptide located within the following region: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDIL
Blocking Peptide:
For anti-DFFA antibody is Catalog # AAP30359 (Previous Catalog # AAPS08806)
Target Reference:
Yan,B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1504-1509
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: DFFA antibody tested with Human Jurkat Cells (ARP30359_T100)

Aviva Systems Biology is the original manufacturer of this DFFA antibody (ARP30359_T100)

Click here to view the DFFA antibody Western Blot Protocol

Product Datasheet Link: DFFA antibody (ARP30359_T100)

WB Suggested Anti-DFFA Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s DFFA antibody (ARP30359_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question