website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

DFFA antibody - N-terminal region (ARP30359_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Gene Symbol:
DFFA
Official Gene Full Name:
DNA fragmentation factor, 45kDa, alpha polypeptide
NCBI Gene Id:
1676
Alias Symbols:
DFF-45; DFF1; Ion ChannelAD; ICAD
Tissue Tool:
Find tissues and cell lines supported to express DFFA.
Protein Accession #:
NP_004392
Nucleotide Accession#:
NM_004401
Swissprot Id:
O00273
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
DNA fragmentation factor subunit alpha
Protein Size (# AA):
331
Molecular Weight:
37kDa
Application:
WB
Subunit:
alpha
Partner Proteins:
BAK1, BCL6, APEX1, ATF3, ATM, ATM, ATM, ATM, ATR, AURKA, BAK1, BARD1, BAX, BAX, BAX, BCL2L1, BLM, BLM, BLM, BNIP3L, BRCA1, BRCA1, CARM1, CDC25C, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CR2, CREBBP, CUL9, DDX5, DHCR24, EP300, EP300, EP300, ERCC3, ESR1, FOXO3, GPS2, GSK3B, HCVgp1, HCVgp1, HCVgp1, HCVg
Immunogen:
The immunogen for anti-DFFA antibody: synthetic peptide directed towards the N terminal of human DFFA
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
DFFA antibody - N-terminal region (ARP30359_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 83%; Mouse: 83%
Species Reactivity:
Human, Horse, Guinea pig, Bovine, Rat, Dog, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-DFFA antibody
- ARP30359_T100
Peptide Sequence:
Synthetic peptide located within the following region: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDIL
Blocking Peptide:
For anti-DFFA antibody is Catalog # AAP30359 (Previous Catalog # AAPS08806)
Target Reference:
Yan,B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1504-1509
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-DFFA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for DFFA antibody (ARP30359)

Product page for DFFA antibody (ARP30359)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Bovine DFFA antibody; Bos taurus DFFA antibody Q0VC37 91%
Dog DFFA antibody; Canis familiaris DFFA antibody E2QS05 83%
Gray short-tailed opossum DFFA antibody; Monodelphis domestica DFFA antibody F7DI42 83%
Guinea pig DFFA antibody; Cavia porcellus DFFA antibody H0VD47 91%
Horse LOC100057041 antibody; Equus caballus LOC100057041 antibody F6QF18 91%
Human DFFA antibody; Homo sapiens DFFA antibody O00273 100%
Human DFFA antibody; Homo sapiens DFFA antibody O00273-2 100%
Human DFFA antibody; Homo sapiens DFFA antibody Q5T6G6 100%
Human DFFA antibody; Homo sapiens DFFA antibody Q53HN4 100%
Little brown bat DFFA antibody; Myotis lucifugus DFFA antibody G1NSQ7 90%
Lowland gorilla DFFA antibody; Gorilla gorilla gorilla DFFA antibody G3RAD6 100%
Mouse DFFA antibody; Mus musculus DFFA antibody O54786 83%
Mouse DFFA antibody; Mus musculus DFFA antibody O54786-2 83%
Mouse Dffa antibody; Mus musculus Dffa antibody Q8CA98 83%
Mouse Dffa antibody; Mus musculus Dffa antibody Q8C535 83%
Mouse Dffa antibody; Mus musculus Dffa antibody B2KFW9 83%
Northern white-cheeked gibbon DFFA antibody; Nomascus leucogenys DFFA antibody G1RE60 100%
Rat Dffa antibody; Rattus norvegicus Dffa antibody Q9JLT3 91%
Rat Dffa antibody; Rattus norvegicus Dffa antibody Q498U6 91%
Rat Dffa antibody; Rattus norvegicus Dffa antibody D3ZZ88 91%
Rhesus macaque DFFA antibody; Macaca mulatta DFFA antibody F7HGW2 91%
Rhesus macaque DFFA antibody; Macaca mulatta DFFA antibody F7GIW4 91%
Sumatran orangutan DFFA antibody; Pongo abelii DFFA antibody Q5R7N0 100%
White-tufted-ear marmoset LOC100402847 antibody; Callithrix jacchus LOC100402847 antibody F7I3W2 100%
White-tufted-ear marmoset LOC100402847 antibody; Callithrix jacchus LOC100402847 antibody F7FX54 100%

Product Protocols: DFFA antibody tested with Human Jurkat Cells (ARP30359_T100)

Aviva Systems Biology is the original manufacturer of this DFFA antibody (ARP30359_T100)

Click here to view the DFFA antibody Western Blot Protocol

Product Datasheet Link: DFFA antibody (ARP30359_T100)

WB Suggested Anti-DFFA Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:


Description of Target: Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s DFFA antibody (ARP30359_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question