- Description of Target:
- TRAF6 is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein.The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported.
- Gene Symbol:
- TRAF6
- Official Gene Full Name:
- TNF receptor-associated factor 6, E3 ubiquitin protein ligase
- Alias Symbols:
- MGC:3310; RNF85
- Tissue Tool:
- Find tissues and cell lines supported to express TRAF6.

- Protein Accession# :
- NP_004611
- Nucleotide Accession#:
- NM_004620
- Swissprot Id:
- Q9Y4K3
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 522
- Molecular Weight:
- 59kDa
- Application:
- WB
- Partner Proteins:
- CSNK2B, SUB1, BLM, TERF2IP, TINF2, WRN, BLM, TERF2, TERF2IP, TINF2, WRN, XRCC6, BLM, BTBD12, DCLRE1B, MRE11A, NBN, ORC1L, ORC2L, ORC3L, ORC6L, RAD50, TERF2IP, TINF2, WRN, XRCC5, XRCC6
- Immunogen:
- The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- TRAF6 antibody - middle region (ARP30226_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-TRAF6 antibody
- ARP30226_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
- Blocking Peptide:
- For anti-TRAF6 antibody is Catalog # AAP30226 (Previous Catalog # AAPS09104)
- Key Reference:
- Jazdzewski,K., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (20), 7269-7274
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-TRAF6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: TRAF6 antibody tested with Human 293T Cells (ARP30226_P050)
Aviva Systems Biology is the original manufacturer of this TRAF6 antibody (ARP30226_P050)
Click here to view the TRAF6 antibody Western Blot Protocol
Product Datasheet Link: TRAF6 antibody (ARP30226_P050)
WB Suggested Anti-TRAF6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T
Western Blot image: 
Description of Target: TRAF6 is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein.The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s TRAF6 antibody (ARP30226_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


