- Description of Target:
- Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.
- Gene Symbol:
- RGS4
- Official Gene Full Name:
- Regulator of G-protein signaling 4
- Alias Symbols:
- MGC2124; MGC60244; RGP4; SCZD9
- Tissue Tool:
- Find tissues and cell lines supported to express RGS4.
- Protein Accession# :
- NP_005604
- Nucleotide Accession#:
- NM_005613
- Swissprot Id:
- P49798
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 205
- Molecular Weight:
- 23kDa
- Application:
- WB
- Partner Proteins:
- GNAT1, GNB5, GUCY2D, RGS9BP
- Immunogen:
- The immunogen for anti-RGS4 antibody: synthetic peptide directed towards the C terminal of human RGS4
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- RGS4 antibody - C-terminal region (ARP30213_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Mouse: 100%; Rat: 100%; Dog: 92%; Bovine: 85%; Pig: 85%; Rabbit: 85%; Sheep: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-RGS4 antibody
- ARP30213_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL
- Blocking Peptide:
- For anti-RGS4 antibody is Catalog # AAP30213 (Previous Catalog # AAPS09011)
- Key Reference:
- Ishii,M., (2005) Biochem. Biophys. Res. Commun. 338 (2), 839-846
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-RGS4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: RGS4 antibody tested with Human Jurkat Cells (ARP30213_P050)
Aviva Systems Biology is the original manufacturer of this RGS4 antibody (ARP30213_P050)
Click here to view the RGS4 antibody Western Blot Protocol
Product Datasheet Link: RGS4 antibody (ARP30213_P050)
WB Suggested Anti-RGS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat
Western Blot image: 
Description of Target: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s RGS4 antibody (ARP30213_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
