RELA antibody - middle region (ARP30305_P050)

Catalog#: ARP30305_P050

• Size: 50ug

Human Jurkat

Human cell lines

Human breast

• Description of Target: p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA, or RELB (MIM 604758) to form the NFKB complex. The p50 (NFKB1)/p65 (RELA) heterodimer is the most abundant form of NFKB. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NFKB complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1760 M62399.1 8-1767
• Gene Symbol: RELA
• Official Gene Full Name: V-rel reticuloendotheliosis viral oncogene homolog A (avian)
• Alias Symbols: MGC131774; NFKB3; p65
• Protein Accession#: NP_068810
• Nucleotide Accession#: NM_021975
• Swissprot Id: Q04206
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 551
• Molecular Weight: 60kDa
• Application: WB
• Partner Proteins: BAK1, BCL6, APEX1, ATF3, ATM, ATM, ATM, ATM, ATR, AURKA, BAK1, BARD1, BAX, BAX, BAX, BCL2L1, BLM, BLM, BLM, BNIP3L, BRCA1, BRCA1, CARM1, CDC25C, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CR2, CREBBP, CUL9, DDX5, DHCR24, EP300, EP300, EP300, ERCC3, ESR1, FOXO3, GPS2, GSK3B, HCVgp1, HCVgp1, HCVgp1, HCVg
• Immunogen: The immunogen for anti-RELA antibody: synthetic peptide directed towards the middle region of human RELA
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
• Blocking Peptide: For anti-RELA antibody is Catalog # AAP30305 (Previous Catalog # AAPS08709)
• Key Reference: Wittwer,T. (2008) Biochem. Biophys. Res. Commun. 371 (2), 294-297
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-RELA antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: RELA antibody tested with Human Jurkat Cells (ARP30305_P050)

Aviva Systems Biology is the original manufacturer of this RELA antibody (ARP30305_P050)

Click here to view the RELA antibody Western Blot Protocol

Product Datasheet Link: RELA antibody (ARP30305_P050)

WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:


Description of Target: p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA, or RELB (MIM 604758) to form the NFKB complex. The p50 (NFKB1)/p65 (RELA) heterodimer is the most abundant form of NFKB. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NFKB complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1760 M62399.1 8-1767

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RELA antibody (ARP30305_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: RELA antibody-middle region (ARP30305_P050) in HCT116, HT-29, T47D, HEK-293T, MCF7, MDA-MB-231 cells using Western Blot

Product Page for RELA antibody-middle region (ARP30305_P050)

Researcher: Lluis Espinosa, PhD, Cancer Research Program

Application: Western blotting
Species+tissue/cell type: HCT116 (human colon carcinoma cell line), HT-29 (Colon Adenocarcinoma cell line), T47D (Human ductal breast epithelial tumor cell line), HEK-293T, MCF7 (breast cancer cell line), MDA-MB-231 (Breast Adenocarcinoma cell line)
How many ug’s of tissue/cell lysate run on the gel:
1: 50 ug HCT116 cell lysate
2: 50 ug HT-29 cell lysate
3: 50 ug T47D cell lysate
4: 50 ug HEK-293T cell lysate
5: 50 ug MCF7 cell lysate
6: 50 ug MDA-MB-231 cell lysate
Primary antibody dilution: 2 ug/ml
Secondary antibody: Anti-Rabbit HRP

Questionnaire:

How do Aviva's reagents play a role in your experimental goals?

We are currently using some of the AVIVA antibodies for our projects on NFKappaB and Notch pathways.

What type of experimental sample are you using and how did you prepare it?

We have used colorectal cancer cell lines but soon will start with human tissue samples.

What controls were used in your experiment ? Please include your positive control.

To date we have performed Immuno fluorescence, Western blot and Chromatib IP, but we are planning to do IHC and endogenous IP in the near future. We have provided the conditions used in the reports that I already sent. I will also include them when I send new data.

How did you store the antibody after re-suspension?

Aliquoted at -20 degree C.

Have you used another antibody which has worked in your application?

In our testing, we compare your antibodies with the antibodies from Chemicon, Upstate and Santa Cruz that are the other companies we used to work with.

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

We are planning to include your antibodies in our future publications.

Protocol: Western blot analysis of Ls174 colorectal cancer cells (parental cell line compared with cells transfected with an empty vector or a vector codifying for human hes1) using the indicated antibodies. Anti-hes1 was used at 1μg/ml in TBSt and incubated 0/N at 4 degrees. As secondary antibody we used a Goat anti-Rabbit HRP from DAKO.