- Description of Target:
- Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
- Gene Symbol:
- Foxo4
- Official Gene Full Name:
- Forkhead box O4
- Alias Symbols:
- Afxh; MGC117660; Mllt7; afx
- Tissue Tool:
- Find tissues and cell lines supported to express Foxo4.
- Protein Accession# :
- NP_001005872
- Nucleotide Accession#:
- NM_001005872
- Swissprot Id:
- Q99MK2
- Host:
- Rabbit
- Protein Size (# AA):
- 505
- Molecular Weight:
- 54kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Foxo4 antibody - C-terminal region (ARP38710_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Chicken: 91%
- Datasheets / Downloads:
- Printable datasheet for
anti-Foxo4 antibody
- ARP38710_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
- Blocking Peptide:
- For anti-Foxo4 antibody is Catalog # AAP38710
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Foxo4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
