website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

PCBD2 antibody - C-terminal region (ARP60484_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PCBD2
NCBI Gene Id:
84105
Official Gene Full Name:
Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
Protein Name:
Pterin-4-alpha-carbinolamine dehydratase 2
Swissprot Id:
Q9H0N5
Protein Accession #:
NP_115527
Nucleotide Accession #:
NM_032151
Alias Symbols:
DCOH2, DCOHM, PHS2
Description of Target:
PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.
Protein Size (# AA):
130
Molecular Weight:
14kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCBD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCBD2.
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 85%
Complete computational species homology data:
Anti-PCBD2 (ARP60484_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAGEA11; ILF3; APP; TGIF2LY; MED30; ASCC2; CENPK; HES4; PBXIP1; KCNIP3; MED4; AATF; IRF2BP1; ZZZ3; SNW1; C1D; SSX3; CHAF1A; PHF14; MED7; MED21; XBP1; TAL2; STAT3; SSX5; PML; PCBD1; BRF1; GTF2E1; CDC5L; RUNX1T1; PCBD2; MET; HNF1A;
Blocking Peptide:
For anti-PCBD2 (ARP60484_P050) antibody is Catalog # AAPP47878
Datasheets / Downloads:
Printable datasheet for anti-PCBD2 (ARP60484_P050) antibody
 
X
Ask a Question