website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

PCBD2 antibody - C-terminal region (ARP60484_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    PCBD2
    NCBI Gene Id:
    84105
    Official Gene Full Name:
    Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
    Protein Name:
    Pterin-4-alpha-carbinolamine dehydratase 2
    Swissprot Id:
    Q9H0N5
    Protein Accession #:
    NP_115527
    Nucleotide Accession #:
    NM_032151
    Alias Symbols:
    DCOH2, DCOHM, PHS2
    Description of Target:
    PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.
    Protein Size (# AA):
    130
    Molecular Weight:
    14kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PCBD2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PCBD2.
    Species Reactivity:
    Dog, Guinea Pig, Horse, Human, Mouse, Rat
    Predicted Homology Based on Immunogen Sequence:
    Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 85%
    Complete computational species homology data:
    Anti-PCBD2 (ARP60484_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    MAGEA11; ILF3; APP; TGIF2LY; MED30; ASCC2; CENPK; HES4; PBXIP1; KCNIP3; MED4; AATF; IRF2BP1; ZZZ3; SNW1; C1D; SSX3; CHAF1A; PHF14; MED7; MED21; XBP1; TAL2; STAT3; SSX5; PML; PCBD1; BRF1; GTF2E1; CDC5L; RUNX1T1; PCBD2; MET; HNF1A;
    Blocking Peptide:
    For anti-PCBD2 (ARP60484_P050) antibody is Catalog # AAPP47878
    Datasheets / Downloads:
    Printable datasheet for anti-PCBD2 (ARP60484_P050) antibody
     
    X
    Ask a Question