website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

PCBD2 antibody - C-terminal region (ARP60484_P050)

Description of Target:
PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.
Gene Symbol:
PCBD2
Official Gene Full Name:
Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
NCBI Gene Id:
84105
Alias Symbols:
DCOH2; DCOHM; PHS2
Tissue Tool:
Find tissues and cell lines supported to express PCBD2.
Protein Accession #:
NP_115527
Nucleotide Accession#:
NM_032151
Swissprot Id:
Q9H0N5
Host:
Rabbit
Protein Name:
Pterin-4-alpha-carbinolamine dehydratase 2
Protein Size (# AA):
130
Molecular Weight:
14kDa
Application:
WB
Partner Proteins:
MET,PCBD2,AATF,ASCC2,BRF1,C1D,CDC5L,CENPK,CHAF1A,GTF2E1,HES4,HNF1A,IRF2BP1,KCNIP3,MED21,MED30,MED4,MED7,PBXIP1,PCBD1,PHF14,PML,RUNX1T1,SNW1,SSX3,SSX5,STAT3,TAL2,TGIF2LY,XBP1,ZZZ3
Product Format:
Lyophilized powder
Complete computational species homology data:
PCBD2 antibody - C-terminal region (ARP60484_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 86%; Horse: 86%; Mouse: 86%; Pig: 85%; Rat: 85%; Guinea pig: 85%
Species Reactivity:
Human, Dog, Horse, Mouse, Guinea pig, Rat
Datasheets / Downloads:
Printable datasheet for
anti-PCBD2 antibody
- ARP60484_P050
Peptide Sequence:
Synthetic peptide located within the following region: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
Blocking Peptide:
For anti-PCBD2 antibody is Catalog # AAPP47878
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PCBD2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question