P2RX7 antibody - middle region (ARP35112_P050)

Catalog#: ARP35112_P050

• Size: 50ug

Human Stomach

Human OVCAR-3

Hum. Fetal Heart

• Description of Target: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants which would encode different isoforms have been identified although some fit nonsense-mediated decay (NMD) criteria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: P2RX7
• Official Gene Full Name: Purinergic receptor P2X, ligand-gated ion channel, 7
• Alias Symbols: MGC20089; P2X7
• Protein Accession#: NP_002553
• Nucleotide Accession#: NM_002562
• Swissprot Id: Q99572
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 595
• Molecular Weight: 68kDa
• Application: WB
• Partner Proteins: DYNLT1, HSPA9, porB, BAK1, BAX, BCL2L1, BCL2L11, CKMT1A, CKMT1A, DYNLT1, DYNLT3, GSN, HK1, MCL1, PPIF, PRKCE, RAF1, SUMO4, TOMM20, TUBA4A, BAX, BCL2L1, BCL2L11, CYCS, DCD, DYNLT3, GABARAPL2, GSN, KIF5B, MCC, MCL1, PANK2, PRKCE, RAF1, TOMM20, TRAF6
• Immunogen: The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Human: 100%; Dog: 92%; Mouse: 92%; Rabbit: 92%; Horse: 85%; Rat: 84%; Guinea pig: 83%
• Peptide Sequence: Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP
• Blocking Peptide: For anti-P2RX7 antibody is Catalog # AAP35112 (Previous Catalog # AAPP06343)
• Key Reference: Monyer,H., (2008) Inflammation 31 (2), 84-90
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-P2RX7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: P2RX7 antibody tested with Human Fetal Stomach Tissue (ARP35112_P050)

Aviva Systems Biology is the original manufacturer of this P2RX7 antibody (ARP35112_P050)

Click here to view the P2RX7 antibody Western Blot Protocol

Product Datasheet Link: P2RX7 antibody (ARP35112_P050)

WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Stomach

Western Blot image:


Description of Target: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants which would encode different isoforms have been identified although some fit nonsense-mediated decay (NMD) criteria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s P2RX7 antibody (ARP35112_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: P2RX7 antibody-middle region (ARP35112_P050) in transfected HEK-293 using Western blot

Product Page for P2RX7 antibody-middle region (ARP35112_P050)

Researcher: Ronald Sluyter, School of Biological Sciences, University of Wollongong
Application:Western blotting
Species+tissue/cell type: lane 1: 50ug mock transfected HEK-293, Lane 2: 50ug hP2X7 transfected HEK-293, Lane 3: 50ug mP2X7 transfected HEK-293, Lane 4: 50ug rP2X7 transfected HEK-293
Primary antibody dilution: 1:625
Secondary antibody:Anti-rabbit-HRP
Secondary antibody dilution:1:1000

Questionnaire:
How do Aviva’s reagents play a role in your experimental goals?	Detection of P2X7 receptors in mammalian cells and tissues
Have you used another antibody which has worked in your application?	Yes (Alomone)
How did you store the antibody after re-suspension?	Frozen (-20℃).
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):	(1,2) Human P2X7, mouse P2X7, rat P2X4 or mock-transfected HEK-293 cells (3) 50 μg/lane
How many different experimental trials were conducted using the antibody sample?	One
How was this sample prepared?	As per Bartlett, Yerbury, Sluyter (2013) P2X7 Receptor Activation Induces Reactive Oxygen Species Formation and Cell Death in Murine EOC13 Microglia. Mediators of Inflammation 2013: 271813
Primary antibody dilution and incubation time:	Each at 1:625 for 2h (equivalent to Alomone Ab based on mg of Ab/ml)
Secondary antibody used and dilution and incubation time:	Peroxidase-conjugatedgoat anti-rabbit IgG Ab was (Rockland Immunochemicals) at 1:1000 for 1 h
What controls were used in your experiment (positive/negative)?	Positive: Rabbit anti-P2X7 polyAb (Alomone); negative: P2X4 and mock transfected cells
Please include your detailed WB Procedure/Protocol here:	As per Bartlett, Yerbury, Sluyter (2013) P2X7 Receptor Activation Induces Reactive Oxygen Species Formation and Cell Death in Murine EOC13 Microglia. Mediators of Inflammation 2013: 271813