PKDREJ antibody - middle region (ARP35187_P050)

Catalog#: ARP35187_P050

• Size: 50ug

Human HepG2

• Description of Target: PKDREJ is a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction.This intronless gene encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined.
• Gene Symbol: PKDREJ
• Official Gene Full Name: Polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin)
• Alias Symbols: -
• Protein Accession#: NP_006062
• Nucleotide Accession#: NM_006071
• Swissprot Id: Q9NTG1
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 2253
• Molecular Weight: 254kDa
• Application: WB
• Immunogen: The immunogen for anti-PKDREJ antibody: synthetic peptide directed towards the middle region of human PKDREJ
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Chimpanzee:100%; Pygmy chimpanzee:100%; Human:100%; Bornean orangutan:92%; Western Gorilla:85%; 
• Peptide Sequence: Synthetic peptide located within the following region: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG
• Blocking Peptide: For anti-PKDREJ antibody is Catalog # AAP35187 (Previous Catalog # AAPP06422)
• Key Reference: Hamm,D., (2007) Am. J. Hum. Genet. 81 (1), 44-52
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-PKDREJ antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: PKDREJ antibody tested with Human Hepg2 Cells (ARP35187_P050)

Aviva Systems Biology is the original manufacturer of this PKDREJ antibody (ARP35187_P050)

Click here to view the PKDREJ antibody Western Blot Protocol

Product Datasheet Link: PKDREJ antibody (ARP35187_P050)

WB Suggested Anti-PKDREJ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2

Western Blot image:


Description of Target: PKDREJ is a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction.This intronless gene encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PKDREJ antibody (ARP35187_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com