PCBD2 antibody - C-terminal region (ARP60484_P050)

Catalog#: ARP60484_P050

• Size: 50ug

Human THP-1

• Description of Target: PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.
• Gene Symbol: PCBD2
• Official Gene Full Name: Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
• Alias Symbols: DCOH2; DCOHM; PHS2
• Protein Accession#: NP_115527
• Nucleotide Accession#: NM_032151
• Swissprot Id: Q9H0N5
• Host: Rabbit
• Protein Size (# AA): 130
• Molecular Weight: 14kDa
• Application: WB
• Partner Proteins: MET,PCBD2,AATF,ASCC2,BRF1,C1D,CDC5L,CENPK,CHAF1A,GTF2E1,HES4,HNF1A,IRF2BP1,KCNIP3,MED21,MED30,MED4,MED7,PBXIP1,PCBD1,PHF14,PML,RUNX1T1,SNW1,SSX3,SSX5,STAT3,TAL2,TGIF2LY,XBP1,ZZZ3
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Chicken: 84%; African clawed frog: 78%
• Peptide Sequence: Synthetic peptide located within the following region: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
• Blocking Peptide: For anti-PCBD2 antibody is Catalog # AAPP47878
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-PCBD2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.