website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

P2RX5 antibody - N-terminal region (ARP35511_P050)

Description of Target:
P2RX5 is the receptor for ATP that acts as a ligand gated ion channel.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.
Gene Symbol:
P2RX5
Official Gene Full Name:
Purinergic receptor P2X, ligand-gated ion channel, 5
Alias Symbols:
MGC47755; P2X5; P2X5R; LRH-1
Tissue Tool:
Find tissues and cell lines supported to express P2RX5.
Protein Accession# :
NP_778256
Nucleotide Accession#:
NM_175081
Swissprot Id:
Q93086
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
422
Molecular Weight:
47kDa
Application:
WB
Partner Proteins:
CDH5, CDH5
Immunogen:
The immunogen for anti-P2RX5 antibody: synthetic peptide directed towards the N terminal of human P2RX5
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
P2RX5 antibody - N-terminal region (ARP35511_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 85%; Rat: 85%; Bovine: 84%; Chicken: 84%; Rabbit: 78%; Dog: 76%
Datasheets / Downloads:
Printable datasheet for
anti-P2RX5 antibody
- ARP35511_P050
Peptide Sequence:
Synthetic peptide located within the following region: LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR
Blocking Peptide:
For anti-P2RX5 antibody is Catalog # AAP35511 (Previous Catalog # AAPP06751)
Key Reference:
Hallcher,L.M. (2007) Mol. Pharmacol. 72 (6), 1402-1405
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-P2RX5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: P2RX5 antibody tested with Human Nci-H226 Cells (ARP35511_P050)

Aviva Systems Biology is the original manufacturer of this P2RX5 antibody (ARP35511_P050)

Click here to view the P2RX5 antibody Western Blot Protocol

Product Datasheet Link: P2RX5 antibody (ARP35511_P050)

WB Suggested Anti-P2RX5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: NCI-H226

Western Blot image:


Description of Target: P2RX5 is the receptor for ATP that acts as a ligand gated ion channel.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s P2RX5 antibody (ARP35511_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com