GRM6 antibody - C-terminal region (ARP32597_P050)

Catalog#: ARP32597_P050

• Size: 50ug

Human Brain

Mouse retina

• Description of Target: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. GRM6 is part of Group III which is linked to the inhibition of the cyclic AMP cascade.
• Gene Symbol: GRM6
• Official Gene Full Name: Glutamate receptor, metabotropic 6
• Alias Symbols: mGlu6; CSNB1B; GPRC1F; MGLUR6
• Protein Accession#: NP_000834
• Nucleotide Accession#: NM_000843
• Swissprot Id: O15303
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 877
• Molecular Weight: 95kDa
• Application: WB
• Partner Proteins: ERCC3, ERCC5, GTF2E1, BRCA1, BTAF1, CDK7, ERCC3, GTF2B, GTF2E1, GTF2F1, GTF2H2, MED21, POLR2A, TBP
• Immunogen: The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL
• Blocking Peptide: For anti-GRM6 antibody is Catalog # AAP32597 (Previous Catalog # AAPP03604)
• Key Reference: Hashimoto,T., et al., (1997) Eur. J. Neurosci. 9 (6), 1226-1235
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-GRM6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: GRM6 antibody tested with Human Fetal Brain Tissue (ARP32597_P050)

Aviva Systems Biology is the original manufacturer of this GRM6 antibody (ARP32597_P050)

Click here to view the GRM6 antibody Western Blot Protocol

Product Datasheet Link: GRM6 antibody (ARP32597_P050)

WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:


Description of Target: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. GRM6 is part of Group III which is linked to the inhibition of the cyclic AMP cascade.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GRM6 antibody (ARP32597_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: GRM6 antibody-C-terminal region (ARP32597_P050) in Mouse retina lysate using Western Blot

Product Page for GRM6 antibody-C-terminal region (ARP32597_P050)

Application: Western blotting
Species+tissue/cell type: Mouse retina lysate
How many ug’s of tissue/cell lysate run on the gel:
1: 10 ug WT mouse retina lysate
2: 10 ug GRM6 knockout mouse retina lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:10000

Western Blot:

• Samples from retina lysates of wild type (wt) and nob3 (mGluR6 knock out) mice warmed 10’ at 37°C
• Loaded 10 ug/well
• Blocked 1 hour, room temperature, with 5% Milk-PBST (0.1% Tween)
• 1 hour incubation with primary antibodies diluted 1:1000 (1 ug/ml), room temperature, in 1% Milk-PBST
• 4 washes in PBST
• 1 hour incubation with secondary anti-rabbit-HRP conjugated antibody diluted 1:10000 (0.04 ug/ml), room temperature, in 1% Milk-PBST
• 4 washes in PBST
• Developed using SuperSignal West Femto Chemiluminescent Substrate diluted 1:5
• 30 seconds exposure