website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

INSM2 antibody - middle region (ARP30029_P050)

Description of Target:
The function of INSM2 remains unknown.
Gene Symbol:
Official Gene Full Name:
Insulinoma-associated 2
NCBI Gene Id:
Alias Symbols:
IA-6; mlt1; IA6
Tissue Tool:
Find tissues and cell lines supported to express INSM2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Insulinoma-associated protein 2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-INSM2 antibody: synthetic peptide directed towards the middle region of human INSM2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
INSM2 antibody - middle region (ARP30029_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Rabbit: 93%; Guinea pig: 93%
Species Reactivity:
Bovine, Rat, Dog, Zebrafish, Pig, Horse, Human, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-INSM2 antibody
- ARP30029_P050
Peptide Sequence:
Synthetic peptide located within the following region: GIKKPKAMRKLSFADEVTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFI
Blocking Peptide:
For anti-INSM2 antibody is Catalog # AAP30029 (Previous Catalog # AAPH00205)
Key Reference:
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-INSM2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question