website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

INSM2 antibody - middle region (ARP30029_P050)

Description of Target:
The function of INSM2 remains unknown.
Gene Symbol:
Official Gene Full Name:
Insulinoma-associated 2
NCBI Gene Id:
Alias Symbols:
IA-6; mlt1; IA6
Tissue Tool:
Find tissues and cell lines supported to express INSM2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Insulinoma-associated protein 2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-INSM2 antibody: synthetic peptide directed towards the middle region of human INSM2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
INSM2 antibody - middle region (ARP30029_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Rabbit: 93%; Guinea pig: 93%
Species Reactivity:
Bovine, Rat, Dog, Zebrafish, Pig, Horse, Human, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-INSM2 antibody
- ARP30029_P050
Peptide Sequence:
Synthetic peptide located within the following region: GIKKPKAMRKLSFADEVTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFI
Blocking Peptide:
For anti-INSM2 antibody is Catalog # AAP30029 (Previous Catalog # AAPH00205)
Target Reference:
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for INSM2 antibody (ARP30029)

Product page for INSM2 antibody (ARP30029)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog insm1 antibody; Xenopus laevis insm1 antibody A7UKY7 100%
African elephant INSM1 antibody; Loxodonta africana INSM1 antibody G3UKV4 100%
African elephant INSM2 antibody; Loxodonta africana INSM2 antibody G3UIM9 100%
African elephant INSM2 antibody; Loxodonta africana INSM2 antibody G3TVP6 100%
Atlantic salmon insm1 antibody; Salmo salar insm1 antibody B5X375 92%
Bovine Bt.34523 antibody; Bos taurus Bt.34523 antibody G3N2V2 100%
Bovine INSM1 antibody; Bos taurus INSM1 antibody A6H7J1 100%
Dog INSM1 antibody; Canis familiaris INSM1 antibody F1P7P2 100%
Dog INSM2 antibody; Canis familiaris INSM2 antibody E2R547 100%
Giant panda INSM1 antibody; Ailuropoda melanoleuca INSM1 antibody G1L093 100%
Giant panda INSM2 antibody; Ailuropoda melanoleuca INSM2 antibody D2HKI4 100%
Gray short-tailed opossum INSM1 antibody; Monodelphis domestica INSM1 antibody F6ZV15 100%
Green anole LOC100552984 antibody; Anolis carolinensis LOC100552984 antibody G1KYJ3 92%
Guinea pig INSM2 antibody; Cavia porcellus INSM2 antibody H0W366 92%
Horse INSM2 antibody; Equus caballus INSM2 antibody F6PJ31 100%
Human INSM1 antibody; Homo sapiens INSM1 antibody Q01101 100%
Human INSM2 antibody; Homo sapiens INSM2 antibody Q96T92 100%
Lowland gorilla INSM1 antibody; Gorilla gorilla gorilla INSM1 antibody G3RUX5 100%
Lowland gorilla INSM2 antibody; Gorilla gorilla gorilla INSM2 antibody G3S379 100%
Mouse INSM1 antibody; Mus musculus INSM1 antibody Q63ZV0 100%
Mouse Insm1 antibody; Mus musculus Insm1 antibody Q05BD7 100%
Mouse INSM2 antibody; Mus musculus INSM2 antibody Q9JMC2 100%
Northern white-cheeked gibbon INSM2 antibody; Nomascus leucogenys INSM2 antibody G1QU56 100%
Pig INSM1 antibody; Sus scrofa INSM1 antibody F1SAU8 100%
Pig INSM2 antibody; Sus scrofa INSM2 antibody F1SHJ1 100%
Rabbit LOC100357857 antibody; Oryctolagus cuniculus LOC100357857 antibody G1SRR1 92%
Rat Insm2 antibody; Rattus norvegicus Insm2 antibody D3ZKF8 100%
Rhesus macaque INSM2 antibody; Macaca mulatta INSM2 antibody F7G7V4 100%
Small-eared galago INSM1 antibody; Otolemur garnettii INSM1 antibody H0XJ19 100%
Small-eared galago INSM2 antibody; Otolemur garnettii INSM2 antibody H0XMY3 100%
Tasmanian devil INSM2 antibody; Sarcophilus harrisii INSM2 antibody G3W3C9 100%
Three-spined stickleback INSM1 antibody; Gasterosteus aculeatus INSM1 antibody G3NVC2 92%
Three-spined stickleback INSM2 antibody; Gasterosteus aculeatus INSM2 antibody G3PG12 92%
Western clawed frog insm1 antibody; Xenopus tropicalis insm1 antibody Q0VA44 100%
Western clawed frog insm1 antibody; Xenopus tropicalis insm1 antibody A4IHR5 100%
Western clawed frog LOC100486087 antibody; Xenopus tropicalis LOC100486087 antibody F7EBY8 100%
White-tufted-ear marmoset INSM1 antibody; Callithrix jacchus INSM1 antibody F7HC62 100%
White-tufted-ear marmoset INSM2 antibody; Callithrix jacchus INSM2 antibody F6QBD1 100%
Zebra finch INSM1 antibody; Taeniopygia guttata INSM1 antibody H0ZB88 92%
Zebrafish insm1a antibody; Danio rerio insm1a antibody Q6P0F9 92%
Zebrafish insm1a antibody; Danio rerio insm1a antibody Q3S5C8 92%
Zebrafish insm1a antibody; Danio rerio insm1a antibody F8W3Z6 92%
Zebrafish insm1b antibody; Danio rerio insm1b antibody Q7T3H2 100%
Zebrafish insm1b antibody; Danio rerio insm1b antibody Q3S5C7 100%

Product Protocols: INSM2 antibody tested with Human Thp-1 Cells (ARP30029_P050)

Aviva Systems Biology is the original manufacturer of this INSM2 antibody (ARP30029_P050)

Click here to view the INSM2 antibody Western Blot Protocol

Product Datasheet Link: INSM2 antibody (ARP30029_P050)

WB Suggested Anti-INSM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1

Western Blot image:

Description of Target: The function of INSM2 remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s INSM2 antibody (ARP30029_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question