website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GH2 antibody - middle region (ARP42013_T100)

Description of Target:
GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.
Gene Symbol:
Official Gene Full Name:
Growth hormone 2
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express GH2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Growth hormone variant
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
GH2 antibody - middle region (ARP42013_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Goat, Sheep, Bovine, Human, Rat, Pig, Horse, Rabbit, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GH2 antibody
- ARP42013_T100
Peptide Sequence:
Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
Blocking Peptide:
For anti-GH2 antibody is Catalog # AAP42013 (Previous Catalog # AAPS11506)
Target Reference:
Lacroix,M.C., (2005) Endocrinology 146 (5), 2434-2444
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GH2 antibody (ARP42013)

Product page for GH2 antibody (ARP42013)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.


Predicted Species & Target Target Reference Predicted Homology
African elephant SOMA antibody; Loxodonta africana SOMA antibody P20392 100%
Alpaca SOMA antibody; Lama guanicoe pacos SOMA antibody P37885 100%
American mink SOMA antibody; Mustela vison SOMA antibody P19795 100%
Black-handed spider monkey GH-N antibody; Ateles geoffroyi GH-N antibody Q8WNE0 84%
Black-handed spider monkey GH-V antibody; Ateles geoffroyi GH-V antibody Q8WND9 100%
Bolivian squirrel monkey SOMA antibody; Saimiri boliviensis boliviensis SOMA antibody P58343 92%
Bovine Bgeq7 antibody; Bos taurus Bgeq7 antibody D8MIT8 100%
Bovine GH1 antibody; Bos taurus GH1 antibody Q5EC27 100%
Bovine GH1 antibody; Bos taurus GH1 antibody Q2PQK4 100%
Bovine GH1 antibody; Bos taurus GH1 antibody Q2PQK3 100%
Bovine GH1 antibody; Bos taurus GH1 antibody Q2PQK2 100%
Bovine GH1 antibody; Bos taurus GH1 antibody Q28116 100%
Bovine SOMA antibody; Bos taurus SOMA antibody P01246 100%
Bowfin growth hormone/ GH antibody; Amia calva growth hormone/ GH antibody Q91386 90%
Cat SOMA antibody; Felis catus SOMA antibody P46404 100%
Chicken GH antibody; Gallus gallus GH antibody Q90WE4 90%
Chicken SOMA antibody; Gallus gallus SOMA antibody P08998 90%
Chimpanzee CSHL1 antibody; Pan troglodytes CSHL1 antibody Q866T8 84%
Chimpanzee PL-A antibody; Pan troglodytes PL-A antibody Q866U1 92%
Chimpanzee PL-B antibody; Pan troglodytes PL-B antibody Q866U0 92%
Chimpanzee SOM2 antibody; Pan troglodytes SOM2 antibody P58757 100%
Chimpanzee SOMA antibody; Pan troglodytes SOMA antibody P58756 100%
Common quail GH antibody; Coturnix coturnix GH antibody B8XY22 90%
Crocodile SOMA antibody; Crocodylus novaeguineae SOMA antibody P55755 90%
Dog SOMA antibody; Canis familiaris SOMA antibody P33711 100%
Domestic duck GH antibody; Anas platyrhynchos GH antibody Q549W9 90%
Domestic duck SOMA antibody; Anas platyrhynchos SOMA antibody P11228 90%
Domestic gayal SOMA antibody; Bos gaurus frontalis SOMA antibody Q1HFN3 100%
Domestic water buffalo GH antibody; Bubalus bubalis GH antibody Q2PQK6 100%
Domestic water buffalo SOMA antibody; Bubalus bubalis SOMA antibody O18938 100%
Dromedary SOMA antibody; Camelus dromedarius SOMA antibody Q7YRR6 100%
Dusky titi monkey ghlp antibody; Callicebus moloch ghlp antibody Q3L3L1 91%
Dusky titi monkey ghlp antibody; Callicebus moloch ghlp antibody Q3L3L2 84%
Dusky titi monkey ghlp antibody; Callicebus moloch ghlp antibody Q3L3L0 83%
European pied flycatcher GH antibody; Ficedula hypoleuca GH antibody Q0ZR66 90%
Finback whale SOMA antibody; Balaenoptera physalus SOMA antibody Q659Q8 100%
Giant panda SOMA antibody; Ailuropoda melanoleuca SOMA antibody Q8HYE5 100%
Giraffe SOMA antibody; Giraffa camelopardalis SOMA antibody Q7YQD2 100%
Goat GH antibody; Capra hircus GH antibody Q19AP0 100%
Goat GH antibody; Capra hircus GH antibody F6N7U9 100%
Goat GH5 antibody; Capra hircus GH5 antibody Q4JQN3 100%
Goat GH5 antibody; Capra hircus GH5 antibody Q3HTF7 100%
Goat GH5 antibody; Capra hircus GH5 antibody Q3HTF6 100%
Goat GH5 antibody; Capra hircus GH5 antibody Q3HTF5 100%
Goat GH5 antibody; Capra hircus GH5 antibody Q3HTF3 100%
Goat SOMA antibody; Capra hircus SOMA antibody P67931 100%
Golden hamster SOMA antibody; Mesocricetus auratus SOMA antibody P37886 100%
Green sea-turtle SOMA antibody; Chelonia mydas SOMA antibody P34005 90%
Hamadryas baboon CSH-A antibody; Papio hamadryas CSH-A antibody C7BCT9 84%
Hamadryas baboon CSH-B antibody; Papio hamadryas CSH-B antibody C7BCU1 84%
Hamadryas baboon CSH-C antibody; Papio hamadryas CSH-C antibody C7BCU3 84%
Hamadryas baboon CSH-C antibody; Papio hamadryas CSH-C antibody C7BCU2 84%
Hamadryas baboon GH antibody; Papio hamadryas GH antibody F6JY45 92%
Hamadryas baboon GH-2 antibody; Papio hamadryas GH-2 antibody C7BCU6 90%
Hippopotamus SOMA antibody; Hippopotamus amphibius SOMA antibody Q7YQB8 100%
Horse GH1 antibody; Equus caballus GH1 antibody F6WLH6 100%
Horse SOMA antibody; Equus caballus SOMA antibody P01245 100%
Human CSH antibody; Homo sapiens CSH antibody P01243 92%
Human CSH1 antibody; Homo sapiens CSH1 antibody Q7KZ35 92%
Human CSH1 antibody; Homo sapiens CSH1 antibody Q6PF11 92%
Human CSH1 antibody; Homo sapiens CSH1 antibody H0YMT7 92%
Human CSH1 antibody; Homo sapiens CSH1 antibody B1A4H2 92%
Human CSH1 antibody; Homo sapiens CSH1 antibody A8K6C2 92%
Human CSH2 antibody; Homo sapiens CSH2 antibody P78451 92%
Human CSH2 antibody; Homo sapiens CSH2 antibody H0YM39 92%
Human CSH2 antibody; Homo sapiens CSH2 antibody B1A4H9 92%
Human CSHL antibody; Homo sapiens CSHL antibody Q14406 92%
Human CSHL antibody; Homo sapiens CSHL antibody Q14406-4 92%
Human CSHL antibody; Homo sapiens CSHL antibody Q14406-3 92%
Human CSHL antibody; Homo sapiens CSHL antibody Q14406-2 92%
Human GH1 antibody; Homo sapiens GH1 antibody Q6IYF1 100%
Human GH1 antibody; Homo sapiens GH1 antibody Q6IYF0 100%
Human GH1 antibody; Homo sapiens GH1 antibody B1A4G9 100%
Human GH1 antibody; Homo sapiens GH1 antibody B1A4G7 100%
Human GH1 antibody; Homo sapiens GH1 antibody B1A4G6 100%
Human GH1 antibody; Homo sapiens GH1 antibody A6NEF6 100%
Human GH2 antibody; Homo sapiens GH2 antibody Q6FH54 100%
Human GH2 antibody; Homo sapiens GH2 antibody Q6FH32 100%
Human GH2 antibody; Homo sapiens GH2 antibody O14643 100%
Human GH2 antibody; Homo sapiens GH2 antibody C9JRP3 100%
Human GH2 antibody; Homo sapiens GH2 antibody B1A4H5 100%
Human SOM2 antibody; Homo sapiens SOM2 antibody P01242 100%
Human SOMA antibody; Homo sapiens SOMA antibody P01241 100%
Human SOMA antibody; Homo sapiens SOMA antibody P01241-4 100%
Human SOMA antibody; Homo sapiens SOMA antibody P01241-3 100%
Human SOMA antibody; Homo sapiens SOMA antibody P01241-2 100%
Lesser Malay chevrotain GH-1 antibody; Tragulus javanicus GH-1 antibody Q9BEC0 100%
Lesser Malay chevrotain GH-2 antibody; Tragulus javanicus GH-2 antibody Q9BEB9 100%
Llama GH antibody; Lama glama GH antibody F6KD60 100%
Long-nosed gar SOMA antibody; Lepisosteus osseus SOMA antibody P79885 90%
Lowland gorilla ENSG00000136488 antibody; Gorilla gorilla gorilla ENSG00000136488 antibody G3S0G8 84%
Lowland gorilla ENSG00000189162 antibody; Gorilla gorilla gorilla ENSG00000189162 antibody G3RUR0 92%
Middle East blind mole rat SOMA antibody; Spalax ehrenbergi SOMA antibody O70615 100%
Mouse Gh antibody; Mus musculus Gh antibody Q9R2C3 100%
Mouse Gh antibody; Mus musculus Gh antibody Q8BK24 100%
Mouse Gh antibody; Mus musculus Gh antibody B1ARJ8 100%
Mouse SOMA antibody; Mus musculus SOMA antibody P06880 100%
Northern lesser bushbaby SOMA antibody; Galago senegalensis SOMA antibody Q9GKA1 100%
Northern white-cheeked gibbon LOC100579700 antibody; Nomascus leucogenys LOC100579700 antibody G1RZ63 100%
Northern white-cheeked gibbon LOC100580921 antibody; Nomascus leucogenys LOC100580921 antibody G1RZ57 84%
Olive baboon CSH1 antibody; Papio anubis CSH1 antibody C7SCY4 84%
Olive baboon GH antibody; Papio anubis GH antibody Q2F2Y2 92%
Olive baboon LOC100379157 antibody; Papio anubis LOC100379157 antibody C7SCY3 90%
Pig GH antibody; Sus scrofa GH antibody Q4JHT1 100%
Pig GH antibody; Sus scrofa GH antibody E1U5L2 100%
Pig GH1 antibody; Sus scrofa GH1 antibody Q28957 100%
Pig GH1 antibody; Sus scrofa GH1 antibody F6M7Y8 100%
Pig pGH antibody; Sus scrofa pGH antibody Q53YN7 100%
Pig pGH antibody; Sus scrofa pGH antibody Q4KVL6 100%
Pig pGH antibody; Sus scrofa pGH antibody G2XKX9 100%
Pig SOMA antibody; Sus scrofa SOMA antibody P01248 100%
Pygmy slow loris SOMA antibody; Nycticebus pygmaeus SOMA antibody Q9GMB2 100%
Rabbit SOMA antibody; Oryctolagus cuniculus SOMA antibody P46407 100%
Rat Gh1 antibody; Rattus norvegicus Gh1 antibody B2RYR2 100%
Rat SOMA antibody; Rattus norvegicus SOMA antibody P01244 100%
Red deer gh antibody; Cervus elaphus gh antibody Q4GX12 100%
Red deer SOMA antibody; Cervus elaphus SOMA antibody P56437 100%
Red fox SOMA antibody; Vulpes vulpes SOMA antibody P10766 100%
Red howler monkey ghlp antibody; Alouatta seniculus ghlp antibody Q3L3L4 100%
Red howler monkey ghlp antibody; Alouatta seniculus ghlp antibody Q3L3L5 90%
Red howler monkey ghlp antibody; Alouatta seniculus ghlp antibody Q3L3L7 84%
Reeve turtle GH antibody; Chinemys reevesii GH antibody A3RLA7 90%
Rhesus macaque GH1 antibody; Macaca mulatta GH1 antibody Q1L7U5 90%
Rhesus macaque GH2 antibody; Macaca mulatta GH2 antibody Q1L7V0 92%
Rhesus macaque GH-2 antibody; Macaca mulatta GH-2 antibody Q1L7U8 90%
Rhesus macaque LOC735307 antibody; Macaca mulatta LOC735307 antibody Q07368 84%
Rhesus macaque LOC735307 antibody; Macaca mulatta LOC735307 antibody Q07367 84%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7HCV0 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7CPM4 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7CPK0 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F6ZQP2 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7HCU8 90%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F6ZQN3 90%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody G1K365 84%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7CPK8 84%
Rhesus macaque SOM2 antibody; Macaca mulatta SOM2 antibody Q07370 90%
Rhesus macaque SOMA antibody; Macaca mulatta SOMA antibody P33093 92%
Ring-tailed lemur GH antibody; Lemur catta GH antibody E7D0T8 100%
Saddleback dolphin SOMA antibody; Delphinus delphis SOMA antibody Q8MI73 100%
Sei whale SOMA antibody; Balaenoptera borealis SOMA antibody P33092 100%
Sheep GH antibody; Ovis aries GH antibody Q9TSG0 100%
Sheep GH antibody; Ovis aries GH antibody Q71VP3 100%
Sheep GH antibody; Ovis aries GH antibody Q71VN8 100%
Sheep GH antibody; Ovis aries GH antibody Q71VN5 100%
Sheep GH antibody; Ovis aries GH antibody Q3S4W2 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBH3 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBH2 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBH1 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBG3 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBG2 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBF8 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBF7 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBF4 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBF0 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBE6 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBE0 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBD4 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBD2 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBD0 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBC8 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBC6 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBC4 100%
Sheep GH antibody; Ovis aries GH antibody Q0QBC0 100%
Sheep GH antibody; Ovis aries GH antibody O19033 100%
Sheep SOMA antibody; Ovis aries SOMA antibody P67930 100%
western gorilla GH antibody; Gorilla gorilla GH antibody F6KKF5 100%
White-faced saki ghlp antibody; Pithecia pithecia ghlp antibody Q3L3K8 91%
White-faced saki ghlp antibody; Pithecia pithecia ghlp antibody Q3L3K7 91%
White-faced saki ghlp antibody; Pithecia pithecia ghlp antibody Q3L3K9 83%
White-fronted capuchin gh antibody; Cebus albifrons gh antibody A0AAU9 92%
White-tufted-ear marmoset ghlp5 antibody; Callithrix jacchus ghlp5 antibody Q8MI75 91%
White-tufted-ear marmoset LOC100392546 antibody; Callithrix jacchus LOC100392546 antibody F7EXC0 84%
White-tufted-ear marmoset LOC100392546 antibody; Callithrix jacchus LOC100392546 antibody A0AAU6 84%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7EXG3 91%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7IGT6 84%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7GET7 84%
White-tufted-ear marmoset SOMA antibody; Callithrix jacchus SOMA antibody Q9GMB3 84%
Wild yak GH antibody; Bos mutus grunniens GH antibody F5BHA9 100%
Wild yak SOMA antibody; Bos mutus grunniens SOMA antibody Q864S7 100%

Product Protocols: GH2 antibody tested with Human Placenta Tissue (ARP42013_T100)

Aviva Systems Biology is the original manufacturer of this GH2 antibody (ARP42013_T100)

Click here to view the GH2 antibody Western Blot Protocol

Product Datasheet Link: GH2 antibody (ARP42013_T100)

WB Suggested Anti-GH2 Antibody Titration: 5.0ug/ml
Positive Control: Placenta

Western Blot image:

Description of Target: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GH2 antibody (ARP42013_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question