website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

GH2 antibody - middle region (ARP42013_T100)

Description of Target:
GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.
Gene Symbol:
GH2
Official Gene Full Name:
Growth hormone 2
NCBI Gene Id:
2689
Alias Symbols:
GH-V; GHL; GHV; hGH-V
Tissue Tool:
Find tissues and cell lines supported to express GH2.
Protein Accession #:
NP_072050
Nucleotide Accession#:
NM_022556
Swissprot Id:
O14643
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Growth hormone variant
Protein Size (# AA):
202
Molecular Weight:
22kDa
Application:
WB
Partner Proteins:
ADORA1, DRD2, DRD5, EYA1, EYA2, GNAZ, NMT1, NUCB1, OPRD1, PRKCD, RAP1GAP, RGS10, RGS19, RGS20, RGS7, EYA2, RAP1GAP, RGS10, RGS19, RGS20, RGS7
Immunogen:
The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
GH2 antibody - middle region (ARP42013_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Goat, Sheep, Bovine, Human, Rat, Pig, Horse, Rabbit, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GH2 antibody
- ARP42013_T100
Peptide Sequence:
Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
Blocking Peptide:
For anti-GH2 antibody is Catalog # AAP42013 (Previous Catalog # AAPS11506)
Key Reference:
Lacroix,M.C., (2005) Endocrinology 146 (5), 2434-2444
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GH2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question