website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

GH2 antibody - middle region (ARP42013_T100)

Description of Target:
GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.
Gene Symbol:
GH2
Official Gene Full Name:
Growth hormone 2
NCBI Gene Id:
2689
Alias Symbols:
GH-V; GHL; GHV; hGH-V
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GH2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GH2.
Swissprot Id:
O14643
Protein Accession #:
NP_072050
Nucleotide Accession #:
NM_022556
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Growth hormone variant
Protein Size (# AA):
202
Molecular Weight:
22kDa
Application:
WB
Protein Interactions:
GHR;
Immunogen:
The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
GH2 antibody - middle region (ARP42013_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Goat, Sheep, Bovine, Human, Rat, Pig, Horse, Rabbit, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GH2 antibody
- ARP42013_T100
Peptide Sequence:
Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
Blocking Peptide:
For anti-GH2 antibody is Catalog # AAP42013 (Previous Catalog # AAPS11506)
Target Reference:
Lacroix,M.C., (2005) Endocrinology 146 (5), 2434-2444
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GH2 antibody tested with Human Placenta Tissue (ARP42013_T100)

Aviva Systems Biology is the original manufacturer of this GH2 antibody (ARP42013_T100)

Click here to view the GH2 antibody Western Blot Protocol

Product Datasheet Link: GH2 antibody (ARP42013_T100)

WB Suggested Anti-GH2 Antibody Titration: 5.0ug/ml
Positive Control: Placenta

Western Blot image:


Description of Target: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GH2 antibody (ARP42013_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question