GH1 antibody - C-terminal region (ARP41762_P050)

Complete computational species homology data:: GH1 antibody - C-terminal region (ARP41762_P050)
Predicted Homology Based on Immunogen Sequence:: Human: 100%; Pig: 84%; Rat: 84%; Bovine: 83%; Horse: 76%
Datasheets / Downloads:: Printable datasheet for
anti-GH1 antibody
- ARP41762_P050
Peptide Sequence:: Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Key Reference:: N/A
Reconstitution and Storage:: Add 50 μl of distilled water. Final anti-GH1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Name	# of Products
bone maturation	4
glucose transport	63
growth hormone receptor signaling pathway	14
JAK-STAT cascade	31
JAK-STAT cascade involved in growth hormone signaling pathway	29
positive regulation of activation of JAK2 kinase activity	9
positive regulation of insulin-like growth factor receptor signaling pathway	15
positive regulation of JAK-STAT cascade	38
positive regulation of MAP kinase activity	56
positive regulation of multicellular organism growth	42
positive regulation of peptidyl-tyrosine phosphorylation	112
positive regulation of phosphatidylinositol 3-kinase cascade	60
positive regulation of receptor internalization	14
positive regulation of tyrosine phosphorylation of Stat3 protein	43
positive regulation of tyrosine phosphorylation of Stat5 protein	37
response to estradiol stimulus	102

Name	# of Products
extracellular region antibodies	1573
extracellular space antibodies	884

Name	# of Products
growth factor activity antibodies	831
growth hormone receptor binding antibodies	22
hormone activity antibodies	494
metal ion binding antibodies	5514
prolactin receptor binding antibodies	47
protein binding antibodies	12191

Name	# of Products
Disease mutation	5332
Dwarfism	206

Protocol:

Tips Information:

See our General FAQ page.

Aviva Systems Biology