website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

GH1 antibody - C-terminal region (ARP41762_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
GH1
Official Gene Full Name:
Growth hormone 1
NCBI Gene Id:
2688
Alias Symbols:
GH; GH-N; GHN; IGHD1B; hGH-N
Tissue Tool:
Find tissues and cell lines supported to express GH1.
Protein Accession #:
NP_072053
Nucleotide Accession#:
NM_022559
Swissprot Id:
P01241-2
Host:
Rabbit
Protein Name:
Somatotropin
Protein Size (# AA):
202
Molecular Weight:
23kDa
Application:
WB
Partner Proteins:
GH1,PRLR,BTRC,GHR,LTA4H,SHC1,STRAP
Product Format:
Lyophilized powder
Complete computational species homology data:
GH1 antibody - C-terminal region (ARP41762_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%; Goat: 83%; Sheep: 83%
Species Reactivity:
Human, Pig, Rat, Rabbit, Mouse, Dog, Guinea pig, Goat, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-GH1 antibody
- ARP41762_P050
Peptide Sequence:
Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-GH1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question