website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!


GH1 antibody - C-terminal region (ARP41762_P050)

  • Catalog#: ARP41762_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Growth hormone 1
    Protein Name:
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    GH, GH-N, GHN, IGHD1B, hGH-N
    Description of Target:
    The function of this protein remains unknown.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express GH1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express GH1.
    Species Reactivity:
    Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
    Predicted Homology Based on Immunogen Sequence:
    Dog: 85%; Goat: 83%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Sheep: 83%
    Complete computational species homology data:
    Anti-GH1 (ARP41762_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    Available upon request
    Datasheets / Downloads:
    Printable datasheet for anti-GH1 (ARP41762_P050) antibody
    Ask a Question