website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

GH1 antibody - C-terminal region (ARP41762_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GH1
NCBI Gene Id:
2688
Official Gene Full Name:
Growth hormone 1
Protein Name:
Somatotropin
Swissprot Id:
P01241-2
Protein Accession #:
NP_072053
Nucleotide Accession #:
NM_022559
Alias Symbols:
GH, GH-N, GHN, IGHD1B, hGH-N
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
202
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GH1.
Species Reactivity:
Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Dog: 85%; Goat: 83%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Sheep: 83%
Complete computational species homology data:
Anti-GH1 (ARP41762_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GHR; BAG3; BTRC; PRLR; GH1; SHC1; STRAP; LTA4H;
Blocking Peptide:
Available upon request
Datasheets / Downloads:
Printable datasheet for anti-GH1 (ARP41762_P050) antibody
 
X
Ask a Question