website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

GH1 antibody - C-terminal region (ARP41762_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
GH1
Official Gene Full Name:
Growth hormone 1
NCBI Gene Id:
2688
Alias Symbols:
GH; GH-N; GHN; IGHD1B; hGH-N
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GH1.
Swissprot Id:
P01241-2
Protein Accession #:
NP_072053
Nucleotide Accession #:
NM_022559
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Somatotropin
Protein Size (# AA):
202
Molecular Weight:
23kDa
Application:
WB
Protein Interactions:
GHR; BAG3; BTRC; PRLR; GH1; SHC1; STRAP; LTA4H;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-GH1 (ARP41762_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 85%; Goat: 83%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Sheep: 83%
Species Reactivity:
Dog; Goat; Guinea Pig; Human; Mouse; Rabbit; Rat; Sheep
Datasheets / Downloads:
Printable datasheet for anti-GH1 (ARP41762_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Blocking Peptide:
Available upon request
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question