website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GH1 antibody - C-terminal region (ARP41762_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Official Gene Full Name:
Growth hormone 1
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express GH1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
GH1 antibody - C-terminal region (ARP41762_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%; Goat: 83%; Sheep: 83%
Species Reactivity:
Human, Pig, Rat, Rabbit, Mouse, Dog, Guinea pig, Goat, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-GH1 antibody
- ARP41762_P050
Peptide Sequence:
Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-GH1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for GH1 antibody (ARP41762)

Product page for GH1 antibody (ARP41762)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SOMA antibody; Loxodonta africana SOMA antibody P20392 84%
Alpaca SOMA antibody; Lama guanicoe pacos SOMA antibody P37885 84%
American mink SOMA antibody; Mustela vison SOMA antibody P19795 84%
Black-handed spider monkey GH-N antibody; Ateles geoffroyi GH-N antibody Q8WNE0 78%
Black-handed spider monkey GH-V antibody; Ateles geoffroyi GH-V antibody Q8WND9 78%
Bolivian squirrel monkey SOMA antibody; Saimiri boliviensis boliviensis SOMA antibody P58343 78%
Bovine GH1 antibody; Bos taurus GH1 antibody Q9N265 83%
Bovine GH1 antibody; Bos taurus GH1 antibody Q5EC27 83%
Bovine SOMA antibody; Bos taurus SOMA antibody P01246 83%
Brush-tailed possum SOMA antibody; Trichosurus vulpecula SOMA antibody O62754 76%
Cat SOMA antibody; Felis catus SOMA antibody P46404 84%
Chicken cGH antibody; Gallus gallus cGH antibody A5YW29 76%
Chicken GH antibody; Gallus gallus GH antibody Q90WE4 76%
Chicken SOMA antibody; Gallus gallus SOMA antibody P08998 76%
Chimpanzee SOM2 antibody; Pan troglodytes SOM2 antibody P58757 85%
Chimpanzee SOMA antibody; Pan troglodytes SOMA antibody P58756 100%
Common quail GH antibody; Coturnix coturnix GH antibody B8XY22 76%
Common turkey SOMA antibody; Meleagris gallopavo SOMA antibody P22077 76%
Dog growth hormone/ GH antibody; Canis familiaris growth hormone/ GH antibody Q95240 84%
Dog SOMA antibody; Canis familiaris SOMA antibody P33711 84%
Domestic duck GH antibody; Anas platyrhynchos GH antibody Q549W9 76%
Domestic duck SOMA antibody; Anas platyrhynchos SOMA antibody P11228 76%
Domestic gayal SOMA antibody; Bos gaurus frontalis SOMA antibody Q1HFN3 83%
Domestic water buffalo SOMA antibody; Bubalus bubalis SOMA antibody O18938 83%
Dromedary SOMA antibody; Camelus dromedarius SOMA antibody Q7YRR6 84%
Dusky titi monkey ghlp antibody; Callicebus moloch ghlp antibody Q3L3L0 85%
Dusky titi monkey ghlp antibody; Callicebus moloch ghlp antibody Q3L3L2 78%
European pied flycatcher GH antibody; Ficedula hypoleuca GH antibody Q0ZR66 84%
Finback whale SOMA antibody; Balaenoptera physalus SOMA antibody Q659Q8 84%
Giant panda SOMA antibody; Ailuropoda melanoleuca SOMA antibody Q8HYE5 84%
Giraffe SOMA antibody; Giraffa camelopardalis SOMA antibody Q7YQD2 83%
Goat SOMA antibody; Capra hircus SOMA antibody P67931 83%
Golden hamster SOMA antibody; Mesocricetus auratus SOMA antibody P37886 84%
Gray short-tailed opossum Mdm.226 antibody; Monodelphis domestica Mdm.226 antibody F6WB26 76%
Gray short-tailed opossum SOMA antibody; Monodelphis domestica SOMA antibody Q9GL60 76%
Green sea-turtle SOMA antibody; Chelonia mydas SOMA antibody P34005 76%
Guinea pig SOMA antibody; Cavia porcellus SOMA antibody Q9JKM4 84%
Hamadryas baboon CSH-A antibody; Papio hamadryas CSH-A antibody C7BCT9 78%
Hamadryas baboon CSH-B antibody; Papio hamadryas CSH-B antibody C7BCU1 78%
Hamadryas baboon CSH-C antibody; Papio hamadryas CSH-C antibody C7BCU3 85%
Hamadryas baboon CSH-C antibody; Papio hamadryas CSH-C antibody C7BCU2 85%
Hamadryas baboon GH antibody; Papio hamadryas GH antibody F6JY45 85%
Hippopotamus SOMA antibody; Hippopotamus amphibius SOMA antibody Q7YQB8 84%
Horse GH antibody; Equus caballus GH antibody B9VU80 76%
Horse GH antibody; Equus caballus GH antibody B5THK0 76%
Horse gh antibody; Equus caballus gh antibody B0M1R0 76%
Horse gh antibody; Equus caballus gh antibody A6P7L5 76%
Horse GH1 antibody; Equus caballus GH1 antibody F6WLH6 76%
Horse SOMA antibody; Equus caballus SOMA antibody P01245 76%
Human GH1 antibody; Homo sapiens GH1 antibody Q6IYF1 100%
Human GH1 antibody; Homo sapiens GH1 antibody Q6IYF0 100%
Human GH1 antibody; Homo sapiens GH1 antibody C9JYZ1 100%
Human GH1 antibody; Homo sapiens GH1 antibody B1A4G7 100%
Human GH1 antibody; Homo sapiens GH1 antibody B1A4G6 100%
Human GH1 antibody; Homo sapiens GH1 antibody A6NEF6 100%
Human GH2 antibody; Homo sapiens GH2 antibody Q6FH54 85%
Human GH2 antibody; Homo sapiens GH2 antibody Q6FH32 85%
Human GH2 antibody; Homo sapiens GH2 antibody O14644 85%
Human GH2 antibody; Homo sapiens GH2 antibody O14643 85%
Human GH2 antibody; Homo sapiens GH2 antibody B1A4H7 85%
Human GH2 antibody; Homo sapiens GH2 antibody B1A4H5 85%
Human SOM2 antibody; Homo sapiens SOM2 antibody P01242 85%
Human SOM2 antibody; Homo sapiens SOM2 antibody P01242-2 85%
Human SOMA antibody; Homo sapiens SOMA antibody P01241 100%
Human SOMA antibody; Homo sapiens SOMA antibody P01241-2 100%
Japanese common newt GH001 antibody; Cynops pyrrhogaster GH001 antibody Q9PU72 84%
Jungle crow GH1A antibody; Corvus macrorhynchos GH1A antibody D7UT03 84%
Jungle crow GH1B antibody; Corvus macrorhynchos GH1B antibody D7UT04 84%
Lesser Malay chevrotain GH-1 antibody; Tragulus javanicus GH-1 antibody Q9BEC0 83%
Lesser Malay chevrotain GH-2 antibody; Tragulus javanicus GH-2 antibody Q9BEB9 83%
Llama GH antibody; Lama glama GH antibody F6KD60 84%
Lowland gorilla ENSG00000189162 antibody; Gorilla gorilla gorilla ENSG00000189162 antibody G3RFY6 100%
Lowland gorilla ENSG00000189162 antibody; Gorilla gorilla gorilla ENSG00000189162 antibody G3REV2 100%
Lowland gorilla ENSG00000189162 antibody; Gorilla gorilla gorilla ENSG00000189162 antibody G3SF70 85%
Middle East blind mole rat SOMA antibody; Spalax ehrenbergi SOMA antibody O70615 76%
Mouse Gh antibody; Mus musculus Gh antibody Q9R2C3 84%
Mouse Gh antibody; Mus musculus Gh antibody Q8BK24 84%
Mouse Gh antibody; Mus musculus Gh antibody B1ARJ8 84%
Mouse SOMA antibody; Mus musculus SOMA antibody P06880 84%
Northern lesser bushbaby SOMA antibody; Galago senegalensis SOMA antibody Q9GKA1 84%
Northern white-cheeked gibbon GH2 antibody; Nomascus leucogenys GH2 antibody G1QVG6 85%
Northern white-cheeked gibbon LOC100579700 antibody; Nomascus leucogenys LOC100579700 antibody G1RZ63 92%
Northern white-cheeked gibbon LOC100580921 antibody; Nomascus leucogenys LOC100580921 antibody G1RZ57 100%
Olive baboon CSH1 antibody; Papio anubis CSH1 antibody C7SCY4 78%
Olive baboon GH antibody; Papio anubis GH antibody Q2F2Y2 100%
Ostrich SOMA antibody; Struthio camelus SOMA antibody Q9PWG3 84%
Pig GH antibody; Sus scrofa GH antibody E1U5L2 84%
Pig GH antibody; Sus scrofa GH antibody D6BJT5 84%
Pig GH antibody; Sus scrofa GH antibody Q4JHT1 76%
Pig GH1 antibody; Sus scrofa GH1 antibody Q28957 84%
Pig GH1 antibody; Sus scrofa GH1 antibody F6M7Y8 84%
Pig pGH antibody; Sus scrofa pGH antibody Q53YN7 84%
Pig pGH antibody; Sus scrofa pGH antibody Q4KVL6 84%
Pig pGH antibody; Sus scrofa pGH antibody G2XKX
Pig SOMA antibody; Sus scrofa SOMA antibody P01248 84%
Pygmy slow loris SOMA antibody; Nycticebus pygmaeus SOMA antibody Q9GMB2 84%
Rabbit SOMA antibody; Oryctolagus cuniculus SOMA antibody P46407 84%
Rat Gh1 antibody; Rattus norvegicus Gh1 antibody B2RYR2 84%
Rat SOMA antibody; Rattus norvegicus SOMA antibody P01244 84%
Red deer SOMA antibody; Cervus elaphus SOMA antibody P56437 83%
Red fox SOMA antibody; Vulpes vulpes SOMA antibody P10766 84%
Red howler monkey ghlp antibody; Alouatta seniculus ghlp antibody Q3L3L4 84%
Red howler monkey ghlp antibody; Alouatta seniculus ghlp antibody Q3L3L7 78%
Red howler monkey ghlp antibody; Alouatta seniculus ghlp antibody Q3L3L5 78%
Reeve turtle GH antibody; Chinemys reevesii GH antibody A3RLA7 76%
Rhesus macaque CSH-1 antibody; Macaca mulatta CSH-1 antibody Q1L7U9 85%
Rhesus macaque CSH-2 antibody; Macaca mulatta CSH-2 antibody Q1L7U7 91%
Rhesus macaque CSH-2 antibody; Macaca mulatta CSH-2 antibody Q07369 91%
Rhesus macaque CSH-3 antibody; Macaca mulatta CSH-3 antibody Q1L7U6 85%
Rhesus macaque GH1 antibody; Macaca mulatta GH1 antibody Q1L7U5 85%
Rhesus macaque GH2 antibody; Macaca mulatta GH2 antibody Q1L7V0 92%
Rhesus macaque LOC735307 antibody; Macaca mulatta LOC735307 antibody Q07368 78%
Rhesus macaque LOC735307 antibody; Macaca mulatta LOC735307 antibody Q07367 78%
Rhesus macaque Mmu.10849 antibody; Macaca mulatta Mmu.10849 antibody F7BH53 85%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7CPL6 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7CPK0 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F6ZQP2 92%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F7HCU8 91%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody F6WLX5 91%
Rhesus macaque Mmu.3288 antibody; Macaca mulatta Mmu.3288 antibody G1K365 78%
Rhesus macaque SOMA antibody; Macaca mulatta SOMA antibody P33093 92%
Ring-tailed lemur GH antibody; Lemur catta GH antibody E7D0T8 76%
Saddleback dolphin SOMA antibody; Delphinus delphis SOMA antibody Q8MI73 84%
Sei whale SOMA antibody; Balaenoptera borealis SOMA antibody P33092 84%
Sheep GH antibody; Ovis aries GH antibody Q9TSG0 83%
Sheep GH antibody; Ovis aries GH antibody Q71VP3 83%
Sheep GH antibody; Ovis aries GH antibody Q71VN6 83%
Sheep SOMA antibody; Ovis aries SOMA antibody P67930 83%
streamside salamander GH antibody; Ambystoma barbouri GH antibody Q7T1C3 84%
western gorilla GH antibody; Gorilla gorilla GH antibody F6KKF5 100%
White-faced saki ghlp antibody; Pithecia pithecia ghlp antibody Q3L3K9 85%
White-fronted capuchin gh antibody; Cebus albifrons gh antibody A0AAU9 78%
White-tufted-ear marmoset ghlp6 antibody; Callithrix jacchus ghlp6 antibody Q8MI74 78%
White-tufted-ear marmoset LOC100392546 antibody; Callithrix jacchus LOC100392546 antibody F7EXC0 78%
White-tufted-ear marmoset LOC100392546 antibody; Callithrix jacchus LOC100392546 antibody A0AAU6 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody G1K2E4 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7IGT6 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7H8S0 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7H3K6 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7GET7 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7FPJ0 78%
White-tufted-ear marmoset LOC100412471 antibody; Callithrix jacchus LOC100412471 antibody F7FAE7 78%
White-tufted-ear marmoset SOMA antibody; Callithrix jacchus SOMA antibody Q9GMB3 78%
Wild yak SOMA antibody; Bos mutus grunniens SOMA antibody Q864S7 83%
Zebra finch GH1 antibody; Taeniopygia guttata GH1 antibody H0YYM2 84%
Zebra finch Tgu.1608 antibody; Taeniopygia guttata Tgu.1608 antibody H0ZTL5 84%
Ask a Question