website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

GCG antibody - N-terminal region (ARP42010_T100)

Description of Target:
GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Gene Symbol:
GCG
Official Gene Full Name:
Glucagon
NCBI Gene Id:
2641
Alias Symbols:
GLP1; GLP2; GRPP
Tissue Tool:
Find tissues and cell lines supported to express GCG.
Protein Accession #:
NP_002045
Nucleotide Accession#:
NM_002054
Swissprot Id:
P01275
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Glucagon
Protein Size (# AA):
180
Molecular Weight:
20kDa
Application:
WB
Partner Proteins:
CPE, CTSL1, GCGR, GLP1R, GLP2R, MEP1A, MEP1B, GLP1R
Immunogen:
The immunogen for anti-GCG antibody: synthetic peptide directed towards the N terminal of human GCG
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
GCG antibody - N-terminal region (ARP42010_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%
Species Reactivity:
Mouse, Dog, Pig, Horse, Rabbit, Bovine, Rat, Human, Guinea pig, Sheep, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-GCG antibody
- ARP42010_T100
Peptide Sequence:
Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Blocking Peptide:
For anti-GCG antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503)
Key Reference:
Meier,J.J., (2006) Gastroenterology 130 (1), 44-54
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GCG antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question