website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GCG antibody - N-terminal region (ARP42010_T100)

Description of Target:
GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCG.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-GCG antibody: synthetic peptide directed towards the N terminal of human GCG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
GCG antibody - N-terminal region (ARP42010_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%
Species Reactivity:
Mouse, Dog, Pig, Horse, Rabbit, Bovine, Rat, Human, Guinea pig, Sheep, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-GCG antibody
- ARP42010_T100
Peptide Sequence:
Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Blocking Peptide:
For anti-GCG antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503)
Target Reference:
Meier,J.J., (2006) Gastroenterology 130 (1), 44-54
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GCG antibody tested with Human Jurkat Cells (ARP42010_T100)

Aviva Systems Biology is the original manufacturer of this GCG antibody (ARP42010_T100)

Click here to view the GCG antibody Western Blot Protocol

Product Datasheet Link: GCG antibody (ARP42010_T100)

WB Suggested Anti-GCG Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GCG antibody (ARP42010_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question