website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GCG antibody - N-terminal region (ARP42010_T100)

Description of Target:
GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express GCG.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-GCG antibody: synthetic peptide directed towards the N terminal of human GCG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
GCG antibody - N-terminal region (ARP42010_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%
Species Reactivity:
Mouse, Dog, Pig, Horse, Rabbit, Bovine, Rat, Human, Guinea pig, Sheep, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-GCG antibody
- ARP42010_T100
Peptide Sequence:
Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Blocking Peptide:
For anti-GCG antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503)
Target Reference:
Meier,J.J., (2006) Gastroenterology 130 (1), 44-54
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GCG antibody (ARP42010)

Product page for GCG antibody (ARP42010)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog GLUC1 antibody; Xenopus laevis GLUC1 antibody O42143 100%
African clawed frog GLUC1 antibody; Xenopus laevis GLUC1 antibody O42143-2 100%
African clawed frog GLUC2 antibody; Xenopus laevis GLUC2 antibody O42144 100%
African elephant LOC100676198 antibody; Loxodonta africana LOC100676198 antibody G3SWM5 100%
Alligator gar GLUC antibody; Atractosteus spatula GLUC antibody P09566 90%
American alligator GLUC antibody; Alligator mississippiensis GLUC antibody P68954 100%
American bullfrog GLUC antibody; Rana catesbeiana GLUC antibody P15438 100%
American goosefish GLUC1 antibody; Lophius americanus GLUC1 antibody P01278 75%
American goosefish GLUC2 antibody; Lophius americanus GLUC2 antibody P04092 75%
Bovine GCG antibody; Bos taurus GCG antibody G3MYS1 100%
Bovine GLUC antibody; Bos taurus GLUC antibody P01272 100%
Bowfin GLUC antibody; Amia calva GLUC antibody P33528 90%
Channel catfish LOC100304622 antibody; Ictalurus punctatus LOC100304622 antibody Q6RYB7 75%
Chicken GCG antibody; Gallus gallus GCG antibody Q3HWX1 100%
Chicken GCG antibody; Gallus gallus GCG antibody Q3HWX0 100%
Chicken GLUC antibody; Gallus gallus GLUC antibody P68259 100%
Chicken GLUC antibody; Gallus gallus GLUC antibody P68259-2 100%
Chicken LOC100858942 antibody; Gallus gallus LOC100858942 antibody C0J3M5 83%
Common squirrel monkey GLUC antibody; Saimiri sciureus GLUC antibody P68275 100%
Common turkey GCG antibody; Meleagris gallopavo GCG antibody Q3HLJ2 100%
Common turkey GCG antibody; Meleagris gallopavo GCG antibody Q3HLJ1 100%
Common turkey GLUC antibody; Meleagris gallopavo GLUC antibody P68260 100%
Common turkey LOC100542684 antibody; Meleagris gallopavo LOC100542684 antibody G3USX1 83%
Degu GLUC antibody; Octodon degus GLUC antibody P22890 100%
Dog Cfa.88 antibody; Canis familiaris Cfa.88 antibody F1PZA6 100%
Dog Cfa.88 antibody; Canis familiaris Cfa.88 antibody E2RPI2 100%
Dog Cfa.88 antibody; Canis familiaris Cfa.88 antibody E2R8G4 100%
Dog GLUC antibody; Canis familiaris GLUC antibody P29794 100%
Domestic duck GLUC antibody; Anas platyrhynchos GLUC antibody P68952 100%
Dromedary GLUC antibody; Camelus dromedarius GLUC antibody P68273 100%
Gila monster GLUC antibody; Heloderma suspectum GLUC antibody O12956 100%
Gila monster GLUC antibody; Heloderma suspectum GLUC antibody O12956-2 100%
Golden hamster GLUC antibody; Mesocricetus auratus GLUC antibody P01273 100%
Goldfish GLUC antibody; Carassius auratus GLUC antibody P79695 75%
Gray short-tailed opossum GCG antibody; Monodelphis domestica GCG antibody F7F3N7 100%
Guinea pig GLUC antibody; Cavia porcellus GLUC antibody P05110 100%
Horse GCG antibody; Equus caballus GCG antibody F7ABP1 100%
Human GCG antibody; Homo sapiens GCG antibody A8MRR8 100%
Human GLUC antibody; Homo sapiens GLUC antibody P01275 100%
Lowland gorilla GCG antibody; Gorilla gorilla gorilla GCG antibody G3SE96 100%
Lowland gorilla GCG antibody; Gorilla gorilla gorilla GCG antibody G3QHC4 100%
Mexican beaded lizard EXE3 antibody; Heloderma horridum horridum EXE3 antibody P20394 90%
Mouse Gcg antibody; Mus musculus Gcg antibody A2AS86 100%
Mouse Gcg antibody; Mus musculus Gcg antibody A2AS85 100%
Mouse GLUC antibody; Mus musculus GLUC antibody P55095 100%
North American opossum GLUC antibody; Didelphis marsupialis virginiana GLUC antibody P18108 100%
Northern white-cheeked gibbon GCG antibody; Nomascus leucogenys GCG antibody G1QQ90 100%
Ostrich GLUC antibody; Struthio camelus GLUC antibody P68953 100%
Pig GCG antibody; Sus scrofa GCG antibody F1RPQ1 100%
Pig GLUC antibody; Sus scrofa GLUC antibody P01274 100%
Rabbit GLUC antibody; Oryctolagus cuniculus GLUC antibody P68274 100%
Rainbow trout GLUC1 antibody; Oncorhynchus mykiss GLUC1 antibody Q91971 75%
Rainbow trout GLUC1 antibody; Oncorhynchus mykiss GLUC1 antibody Q91971-2 75%
Rat Gcg antibody; Rattus norvegicus Gcg antibody G3V6P5 100%
Rat GLUC antibody; Rattus norvegicus GLUC antibody P06883 100%
Red-eared slider turtle GLUC antibody; Trachemys scripta GLUC antibody P68955 100%
Rhesus macaque GCG antibody; Macaca mulatta GCG antibody F7EF88 100%
Rhesus macaque GCG antibody; Macaca mulatta GCG antibody F7EF82 100%
Sea lamprey GLUC1 antibody; Petromyzon marinus GLUC1 antibody Q9PUR1 91%
Sea lamprey GLUC2 antibody; Petromyzon marinus GLUC2 antibody Q9PUR0 90%
Senegal bichir GLUC antibody; Polypterus senegalus GLUC antibody P0C235 90%
Sheep GLUC antibody; Ovis aries GLUC antibody Q8MJ25 100%
Short-tailed chinchilla GLUC antibody; Chinchilla chinchilla GLUC antibody P31297 100%
Small-eared galago GCG antibody; Otolemur garnettii GCG antibody H0X7B1 100%
Tasmanian devil GCG antibody; Sarcophilus harrisii GCG antibody G3WZV7 100%
Tasmanian devil GCG antibody; Sarcophilus harrisii GCG antibody G3WZV6 100%
Three-spined stickleback GCG (1 of 2) antibody; Gasterosteus aculeatus GCG (1 of 2) antibody G3NPY9 75%
Three-spined stickleback GCG (2 of 2) antibody; Gasterosteus aculeatus GCG (2 of 2) antibody G3PL53 76%
Three-spined stickleback GCG (2 of 2) antibody; Gasterosteus aculeatus GCG (2 of 2) antibody G3PL47 76%
Western clawed frog gcg antibody; Xenopus tropicalis gcg antibody Q6DIZ4 100%
Western clawed frog gcg antibody; Xenopus tropicalis gcg antibody F7D9G8 100%
White-tufted-ear marmoset LOC100399074 antibody; Callithrix jacchus LOC100399074 antibody F7ID40 100%
Zebra finch GCG antibody; Taeniopygia guttata GCG antibody H0Z908 100%
Zebra finch LOC100224734 antibody; Taeniopygia guttata LOC100224734 antibody H0ZU44 100%
Zebrafish CH1073-467M9.1 antibody; Danio rerio CH1073-467M9.1 antibody A8BAR0 75%
Zebrafish gcga antibody; Danio rerio gcga antibody Q9DDE6 75%
Zebrafish gcga antibody; Danio rerio gcga antibody Q5PR39 75%
Zebrafish gcga antibody; Danio rerio gcga antibody F1RD10 75%
Zebrafish gcga antibody; Danio rerio gcga antibody F1R7C2 75%
Zebrafish gcga antibody; Danio rerio gcga antibody F1R169 75%
Zebrafish gcga antibody; Danio rerio gcga antibody B8JLY6 75%
Zebrafish gcga antibody; Danio rerio gcga antibody A8BAR2 75%
Zebrafish gcgb antibody; Danio rerio gcgb antibody B0R1C3 75%

Product Protocols: GCG antibody tested with Human Jurkat Cells (ARP42010_T100)

Aviva Systems Biology is the original manufacturer of this GCG antibody (ARP42010_T100)

Click here to view the GCG antibody Western Blot Protocol

Product Datasheet Link: GCG antibody (ARP42010_T100)

WB Suggested Anti-GCG Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GCG antibody (ARP42010_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question