- Description of Target:
- GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
- Gene Symbol:
- GCG
- Official Gene Full Name:
- Glucagon
- Alias Symbols:
- GLP1; GLP2; GRPP
- Tissue Tool:
- Find tissues and cell lines supported to express GCG.
- Protein Accession# :
- NP_002045
- Nucleotide Accession#:
- NM_002054
- Swissprot Id:
- P01275
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 180
- Molecular Weight:
- 20kDa
- Application:
- WB
- Partner Proteins:
- CPE, CTSL1, GCGR, GLP1R, GLP2R, MEP1A, MEP1B, GLP1R
- Immunogen:
- The immunogen for anti-GCG antibody: synthetic peptide directed towards the N terminal of human GCG
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- GCG antibody - N-terminal region (ARP42010_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 75%
- Datasheets / Downloads:
- Printable datasheet for
anti-GCG antibody
- ARP42010_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
- Blocking Peptide:
- For anti-GCG antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503)
- Key Reference:
- Meier,J.J., (2006) Gastroenterology 130 (1), 44-54
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-GCG antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: GCG antibody tested with Human Jurkat Cells (ARP42010_T100)
Aviva Systems Biology is the original manufacturer of this GCG antibody (ARP42010_T100)
Click here to view the GCG antibody Western Blot Protocol
Product Datasheet Link: GCG antibody (ARP42010_T100)
WB Suggested Anti-GCG Antibody Titration: 1.25ug/ml
Positive Control: Jurkat
Western Blot image: 
Description of Target: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s GCG antibody (ARP42010_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
