website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ESR1 antibody - C-terminal region (ARP31088_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.
Gene Symbol:
Official Gene Full Name:
Estrogen receptor 1
NCBI Gene Id:
Alias Symbols:
DKFZp686N23123; ER; ESR; ESRA; Era; NR3A1
Tissue Tool:
Find tissues and cell lines supported to express ESR1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Estrogen receptor
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-ESR1 antibody: synthetic peptide directed towards the C terminal of human ESR1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
ESR1 antibody - C-terminal region (ARP31088_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-ESR1 antibody
- ARP31088_P050
Peptide Sequence:
Synthetic peptide located within the following region: AHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blocking Peptide:
For anti-ESR1 antibody is Catalog # AAP31088
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ESR1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for ESR1 antibody (ARP31088)

Product page for ESR1 antibody (ARP31088)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Chimpanzee ESR1 antibody; Pan troglodytes ESR1 antibody A2T781 92%
Human ESR1 antibody; Homo sapiens ESR1 antibody P03372 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody P03372-4 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody P03372-2 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody Q9H2M1 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody G4XH65 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody E9PF09 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody E7EVR3 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody C9E0F1 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody C0LJA8 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody B5TZ79 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody B5TKC2 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody B5TKC0 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody B5LY05 100%
Human ESR1 antibody; Homo sapiens ESR1 antibody C0LLI9 100%
Human NR3A1 antibody; Homo sapiens NR3A1 antibody B6ZGU3 100%
Lowland gorilla ESR1 antibody; Gorilla gorilla gorilla ESR1 antibody G3R2K1 92%
Northern white-cheeked gibbon ESR1 antibody; Nomascus leucogenys ESR1 antibody G1RZN0 84%
Olive baboon ESR1 antibody; Papio anubis ESR1 antibody B6CK19 85%
Pygmy chimpanzee ESR1 antibody; Pan paniscus ESR1 antibody A1YGA7 92%
Rhesus macaque ESR1 antibody; Macaca mulatta ESR1 antibody F6QUN5 85%
Rhesus macaque Mmu.3492 antibody; Macaca mulatta Mmu.3492 antibody F6R2H0 85%
Rhesus macaque Mmu.3492 antibody; Macaca mulatta Mmu.3492 antibody F6QUU3 85%
Rhesus macaque Mmu.3492 antibody; Macaca mulatta Mmu.3492 antibody F6QUR4 85%

Product Protocols: ESR1 antibody tested with Human Achn Cells (ARP31088_P050)

Aviva Systems Biology is the original manufacturer of this ESR1 antibody (ARP31088_P050)

Click here to view the ESR1 antibody Western Blot Protocol

Product Datasheet Link: ESR1 antibody (ARP31088_P050)

WB Suggested Anti-ESR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: ACHN

Western Blot image:

Description of Target: ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ESR1 antibody (ARP31088_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question