website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

ESR1 antibody - C-terminal region (ARP31088_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.
Gene Symbol:
ESR1
Official Gene Full Name:
Estrogen receptor 1
NCBI Gene Id:
2099
Alias Symbols:
DKFZp686N23123; ER; ESR; ESRA; Era; NR3A1
Tissue Tool:
Find tissues and cell lines supported to express ESR1.
Protein Accession #:
NP_000116
Nucleotide Accession#:
NM_000125
Swissprot Id:
P03372
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Estrogen receptor
Protein Size (# AA):
595
Molecular Weight:
66kDa
Application:
WB
Partner Proteins:
ANP32A, AXIN2, BCAS2, BLOC1S1, CCND1, CHUK, CTNNB1, DDX17, DDX5, EBAG9, EIF3I, EP300, ESR2, HDAC1, JUN, JUNB, KDM5A, MED1, MPG, MYC, NCOA1, NCOA2, NCOA3, NCOA3, NCOR1, NCOR2, NRIP1, PGR, PGR, PHB2, PRMT2, RBM23, STAT5A, TFF1, TFF1, TP53, TRIM24, TRRAP, AP1B1, ASCC2, BAGE3, C21orf129, CELSR1, CSNK1E, CYB5R3, DSCAM, FHL2, LOC441967, NCAM2, NRIP1, PIAS1, SFI1, SLC37A1, SNAP29, SOD1, TFF1, TFF1, THOC5, UBE2I, XBP1, AHR, AKAP13, AKT1, AKT2, AR, ARHGEF15, ARNT, BAG1, BCAR1, BCAS2, BDNF, BRCA1, CALM1, CALM3, CALM3, CAV1, CCND1, CCNH, CCNT1, CDC25B, CDK7, CEBPB, CHD9, CHUK, CITED1, COBRA1, COPS5, CREBBP, CSNK2B, CTNNB1, CUEDC2, CUL4B, DDX5, DDX54, DNTTIP2, DUT, EGFR, EIF3I, EP300, ERBB2, ESR1, ESR2, ESRRA, FHL2, FLII, FOXO1, FOXO3, FOXO4, GADD45B, GADD45G, GNAI1, GRB2, GTF2B, GTF2H1, HEXIM1, HNF4A, HSP90AA1, HSP90AB1, HSPA4, IGF1R, ISL1, ITGB3BP, JUN, JUNB, JUND, KAT5, KDM5A, KIF1A, LCK, LOH3CR2A, MAPK1, MAPK14, MAPK3, MDM2, MED1, MED24, MKNK2, MLL2, MMS19, MNAT1, MPG, MTA1, MTCH2, MVP, NCOA1, NCOA2, NCOA3, NCOA6, NCOA7, NCOR1, NCOR2, NFKB1, NPPA, NR0B1, NR0B2, NR1H4, NR2C1, NR2C2, NR2F1, NR2F6, NRIP1, NSD1, PAK1, PAK6, PELP1, PGR, PHB2, PIAS1, PIAS3, PIK3R1, PIK3R3, PNRC2, POLR1B, POLR2D, POU2F1, POU4F1, POU4F2, PPARGC1A, PPARGC1B, PRDM2, PRKACA, PRMT1, PRMT2, PSMC5, PTGES3, PTPN1, PTPN6, RARA, RBFOX2, RBM23, RBM39, RELA, REXO4, RFX4, RGS3, RNF14, RNF4, RPS6KA1, RPS6KA3, RXRA, SAFB, SAFB2, SHC1, SLC30A9, SMAD2, SMAD3, SMAD4, SMARCA2, SMARCA4, SMARCD3, SMARCE1, SOS1, SP1, SP3, SRC, SREBF1, STAT5A, STRN, STUB1, TAF10, TAP1, TBP, TCF20, TDG, THRA, THRB, TNFRSF14, TP53, TRIM24, TRIM28, TRIM59, TRIP4, TRRAP, TSC2, TUBA1B, TUBB, UBE2I, USF1, WIPI1, XBP1, YWHAH, ZBTB16, ZBTB17, ZNF398, AHR, AHRR, AKAP13, ATAD2, BAG1, BAZ1B, BRCA1, CAV1, CCNC, CCND1, CCNH, CDC25B, CDK7, CDK8, CDKN1A, CEBPA, CEBPB, CITED1, COBRA1, CREBBP, CTNNB1, DAP3, DDX17, DDX5, DDX54, DNTTIP2, EP300, ESR1, ESR2, FKBP4, FKBP5, FLII, FOXO1, FOXO4, GADD45A, GADD45G, GRIP1, GTF2H1, Gadd45b, HDAC1, HDAC4, HDAC5, HDAC7, HDAC9, HSP90AA1, HSPA4, HSPA8, IGF1R, ING1, IRS1, IRS2, ISL1, JUN, KAT2A, KAT5, KDM5A, KLF5, LCOR, LDB1, LMO4, MAPK1, MDM2, MED1, MED10, MED12, MED13, MED14, MED16, MED17, MED20, MED21, MED23, MED24, MED6, MED7, MEN1, MGMT, MNAT1, MSH2, MSH6, MTA1, MTA2, MUC1, MVP, MYC, MYOD1, NCOA1, NCOA2, NCOA3, NCOA4, NCOA6, NCOA7, NCOR1, NGG1, NR0B2, NR2C1, NR2C2, NR2F1, NR2F6, NRIP1, Nr0b2, Nr1i2, Nsd1, PAK6, PARP1, PDLIM1, PELP1, PGC, PHB2, PIAS2, PIK3R1, POU2F1, POU2F2, POU4F1, POU4F2, PPARGC1A, PPARGC1B, PPID, PRDM2, PRKDC, PRMT1, PRMT2, PTEN, PTGES3, PTMA, RBBP4, RBBP7, RBFOX2, RBM39, RELA, REXO4, RLIM, RNF4, RPS6KA1, SAFB, SAFB2, SETD7, SHC1, SIN3A, SMAD2, SMARCA2, SMARCA4, SMARCD1, SMARCE1, SMYD3, SP1, SP2, SP3, SRA1, SRC, STAT3, STAT5A, STUB1, SUMO1, SVIL, TADA3, TAF1A, TAF1B, TBP, TDG, TOP2B, TP53, TRAM1, TRIM24, TRIM25, TRIP4, TRRAP, Tada3, UBC, UBE3A, XBP1, XRCC5, XRCC6, YWHAQ, ZBTB16, ZNF398
Immunogen:
The immunogen for anti-ESR1 antibody: synthetic peptide directed towards the C terminal of human ESR1
Product Format:
Lyophilized powder
Complete computational species homology data:
ESR1 antibody - C-terminal region (ARP31088_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-ESR1 antibody
- ARP31088_P050
Peptide Sequence:
Synthetic peptide located within the following region: AHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blocking Peptide:
For anti-ESR1 antibody is Catalog # AAP31088
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ESR1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question