website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

ESR1 antibody - C-terminal region (ARP31088_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.
Gene Symbol:
ESR1
Official Gene Full Name:
Estrogen receptor 1
NCBI Gene Id:
2099
Alias Symbols:
DKFZp686N23123; ER; ESR; ESRA; Era; NR3A1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ESR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ESR1.
Swissprot Id:
P03372
Protein Accession #:
NP_000116
Nucleotide Accession #:
NM_000125
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Estrogen receptor
Protein Size (# AA):
595
Molecular Weight:
66kDa
Application:
WB
Protein Interactions:
SRC; DDX5; POLR2C; POLR2B; POLR2A; MSH2; TTC5; KAT5; NCOA2; BRCA1; MED24; UBC; PSMB9; MED1; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; ASCC1; TRRAP; PHB2; NCOR1; NCOA1; PIK3CA; IGF1R; HDAC1; NSD1; WIPI1; ESR1; ZNF131; RANBP9;
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ESR1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-ESR1 (ARP31088_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for anti-ESR1 (ARP31088_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: AHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blocking Peptide:
For anti-ESR1 (ARP31088_P050) antibody is Catalog # AAP31088
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ESR1 antibody tested with Human Achn Cells (ARP31088_P050)

Aviva Systems Biology is the original manufacturer of this ESR1 antibody (ARP31088_P050)

Click here to view the ESR1 antibody Western Blot Protocol

Product Datasheet Link: ESR1 antibody (ARP31088_P050)

WB Suggested Anti-ESR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: ACHN

Western Blot image:


Description of Target: ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ESR1 antibody (ARP31088_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question