website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

DKK1 antibody - C-terminal region (ARP48015_T100)

Description of Target:
DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.
Gene Symbol:
Official Gene Full Name:
Dickkopf 1 homolog (Xenopus laevis)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express DKK1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Dickkopf-related protein 1
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
DKK1 antibody - C-terminal region (ARP48015_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86%
Species Reactivity:
Pig, Goat, Rat, Bovine, Dog, Horse, Guinea pig, Sheep, Human, Rabbit, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-DKK1 antibody
- ARP48015_T100
Peptide Sequence:
Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
Blocking Peptide:
For anti-DKK1 antibody is Catalog # AAP48015 (Previous Catalog # AAPS20606)
Key Reference:
Ai,M., (2005) Mol. Cell. Biol. 25 (12), 4946-4955
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-DKK1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question