website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
100ug
$229.00
In Stock

DKK1 antibody - C-terminal region (ARP48015_T100)

Description of Target:
DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.
Gene Symbol:
DKK1
Official Gene Full Name:
Dickkopf 1 homolog (Xenopus laevis)
Alias Symbols:
DKK-1; SK
Tissue Tool:
Find tissues and cell lines supported to express DKK1.
Protein Accession# :
NP_036374
Nucleotide Accession#:
NM_012242
Swissprot Id:
O94907
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
266
Molecular Weight:
26kDa
Application:
WB
Immunogen:
The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
DKK1 antibody - C-terminal region (ARP48015_T100)
Predicted Homology Based on Immunogen Sequence:
African clawed frog: 100%; Bovine: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Mouse: 92%; Chicken: 85%; Zebrafish: 85%
Datasheets / Downloads:
Printable datasheet for
anti-DKK1 antibody
- ARP48015_T100
Peptide Sequence:
Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
Blocking Peptide:
For anti-DKK1 antibody is Catalog # AAP48015 (Previous Catalog # AAPS20606)
Key Reference:
Ai,M., (2005) Mol. Cell. Biol. 25 (12), 4946-4955
Reconstitution and Storage:
Add 100 μl of distilled water. Final anti-DKK1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: DKK1 antibody tested with Human Hepg2 Cells (ARP48015_T100)

Aviva Systems Biology is the original manufacturer of this DKK1 antibody (ARP48015_T100)

Click here to view the DKK1 antibody Western Blot Protocol

Product Datasheet Link: DKK1 antibody (ARP48015_T100)

WB Suggested Anti-DKK1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s DKK1 antibody (ARP48015_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review:DKK1 antibody-C-terminal region (ARP48015_T100) in human PLC/PRF5 cell lysate using Western blot

Product Page for DKK1 antibody-C-terminal region (ARP48015_T100)

Researcher:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong
Application:Western blotting
Species+tissue/cell type: Lane 1: 30ug human PLC/PRF5 cell lysate Lane 2: 30ug DKK1 PLC/PRF5 cell lysate
Primary antibody dilution:1:1000
Secondary antibody:Anti-rabbit-HRP
Secondary antibody dilution:1:10,000

Questionnaire:
Would you use this antibody in future experiments? Under consideration.
Have you used another antibody which has worked in your application? Yes.
How did you store the antibody after re-suspension? 4 degree Celsius
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human Liver Cancer Cell Lines; 30 ug per lane
How many different experimental trials were conducted using the antibody sample? Once
How was this sample prepared? As same as the protocol provided by Aviva Systems Biology.
Primary antibody dilution and incubation time: 1:1000 overnight at 4 degree Celsius
Secondary antibody used and dilution and incubation time: 1:10000 1hour at room temperature
What controls were used in your experiment (positive/negative)? DKK1 overexpressing PLC/PRF/5 cell line
Please include your detailed WB Procedure/Protocol here: As same as the protocol provided by Aviva Systems Biology.