website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

DKK1 antibody - C-terminal region (ARP48015_T100)

Description of Target:
DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.
Gene Symbol:
DKK1
Official Gene Full Name:
Dickkopf 1 homolog (Xenopus laevis)
NCBI Gene Id:
22943
Alias Symbols:
DKK-1; SK
Tissue Tool:
Find tissues and cell lines supported to express DKK1.
Protein Accession #:
NP_036374
Nucleotide Accession#:
NM_012242
Swissprot Id:
O94907
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Dickkopf-related protein 1
Protein Size (# AA):
266
Molecular Weight:
26kDa
Application:
WB
Immunogen:
The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
DKK1 antibody - C-terminal region (ARP48015_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86%
Species Reactivity:
Pig, Goat, Rat, Bovine, Dog, Horse, Guinea pig, Sheep, Human, Rabbit, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-DKK1 antibody
- ARP48015_T100
Peptide Sequence:
Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
Blocking Peptide:
For anti-DKK1 antibody is Catalog # AAP48015 (Previous Catalog # AAPS20606)
Target Reference:
Ai,M., (2005) Mol. Cell. Biol. 25 (12), 4946-4955
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-DKK1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for DKK1 antibody (ARP48015)

Product page for DKK1 antibody (ARP48015)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog dkk1 antibody; Xenopus laevis dkk1 antibody O57464 100%
African clawed frog dkk2 antibody; Xenopus laevis dkk2 antibody Q9DDA4 85%
African elephant LOC100658110 antibody; Loxodonta africana LOC100658110 antibody G3SZG0 85%
African elephant LOC100663226 antibody; Loxodonta africana LOC100663226 antibody G3T2S9 100%
Atlantic salmon dkk1 antibody; Salmo salar dkk1 antibody B5XFA4 85%
Bovine DKK1 antibody; Bos taurus DKK1 antibody E1BM54 100%
Bovine DKK2 antibody; Bos taurus DKK2 antibody A3KMY2 85%
Chicken DKK1 antibody; Gallus gallus DKK1 antibody Q8UUX3 85%
Chicken DKK2 antibody; Gallus gallus DKK2 antibody E1C8N7 85%
Chinese hamster LOC100769380 antibody; Cricetulus griseus LOC100769380 antibody G3H7W8 92%
Common turkey DKK2 antibody; Meleagris gallopavo DKK2 antibody G1N2J0 85%
Dog DKK1 antibody; Canis familiaris DKK1 antibody F1PQL2 100%
Dog DKK2 antibody; Canis familiaris DKK2 antibody E2R5X7 85%
Duckbill platypus DKK1 antibody; Ornithorhynchus anatinus DKK1 antibody F7G5A9 100%
Duckbill platypus DKK1 antibody; Ornithorhynchus anatinus DKK1 antibody F7G5A5 100%
Duckbill platypus DKK2 antibody; Ornithorhynchus anatinus DKK2 antibody F6PW51 85%
Giant panda LOC100466975 antibody; Ailuropoda melanoleuca LOC100466975 antibody D2H5H2 85%
Giant panda LOC100481257 antibody; Ailuropoda melanoleuca LOC100481257 antibody D2HH81 100%
Goat Dkk1 antibody; Capra hircus Dkk1 antibody C9EAF3 100%
Gray short-tailed opossum DKK1 antibody; Monodelphis domestica DKK1 antibody F7ASV4 92%
Gray short-tailed opossum DKK1 antibody; Monodelphis domestica DKK1 antibody F6W2I3 92%
Gray short-tailed opossum LOC100012384 antibody; Monodelphis domestica LOC100012384 antibody F6ZB66 85%
Guinea pig DKK1 antibody; Cavia porcellus DKK1 antibody H0VX04 100%
Guinea pig LOC100715224 antibody; Cavia porcellus LOC100715224 antibody H0UTG4 85%
Horse DKK1 antibody; Equus caballus DKK1 antibody F6SH59 100%
Horse LOC100064408 antibody; Equus caballus LOC100064408 antibody F7DSU2 85%
Human DKK1 antibody; Homo sapiens DKK1 antibody O94907 100%
Human DKK2 antibody; Homo sapiens DKK2 antibody Q9UBU2 85%
Human DKK2 antibody; Homo sapiens DKK2 antibody D6RGF1 85%
Human DKK2 antibody; Homo sapiens DKK2 antibody D6RCC2 85%
Little brown bat DKK1 antibody; Myotis lucifugus DKK1 antibody G1PK70 100%
Little brown bat DKK2 antibody; Myotis lucifugus DKK2 antibody G1NZ36 85%
Lowland gorilla DKK1 antibody; Gorilla gorilla gorilla DKK1 antibody G3QJC6 100%
Lowland gorilla DKK2 antibody; Gorilla gorilla gorilla DKK2 antibody G3RQ16 85%
Mouse DKK1 antibody; Mus musculus DKK1 antibody O54908 92%
Mouse Dkk1 antibody; Mus musculus Dkk1 antibody Q80UL5 92%
Mouse DKK2 antibody; Mus musculus DKK2 antibody Q9QYZ8 85%
Mouse Dkk2 antibody; Mus musculus Dkk2 antibody Q8BFW0 85%
Northern white-cheeked gibbon LOC100595348 antibody; Nomascus leucogenys LOC100595348 antibody G1RRE1 85%
Northern white-cheeked gibbon LOC100598275 antibody; Nomascus leucogenys LOC100598275 antibody G1RMY5 100%
Pig DKK1 antibody; Sus scrofa DKK1 antibody F1SD03 100%
Pig DKK1 antibody; Sus scrofa DKK1 antibody B8K2M3 100%
Pig DKK2 antibody; Sus scrofa DKK2 antibody F1S121 85%
Rabbit DKK1 antibody; Oryctolagus cuniculus DKK1 antibody Q6PVU5 100%
Rabbit LOC100340336 antibody; Oryctolagus cuniculus LOC100340336 antibody G1SG28 85%
Rat Dkk1 antibody; Rattus norvegicus Dkk1 antibody D3Z9J1 100%
Rat Dkk2 antibody; Rattus norvegicus Dkk2 antibody D3ZN48 85%
Rhesus macaque DKK1 antibody; Macaca mulatta DKK1 antibody F7G3K1 100%
Rhesus macaque DKK2 antibody; Macaca mulatta DKK2 antibody F7GS28 85%
Small-eared galago DKK1 antibody; Otolemur garnettii DKK1 antibody H0WPI3 100%
Small-eared galago DKK2 antibody; Otolemur garnettii DKK2 antibody H0WG41 85%
Tasmanian devil DKK1 antibody; Sarcophilus harrisii DKK1 antibody G3WQK8 100%
Tasmanian devil DKK2 antibody; Sarcophilus harrisii DKK2 antibody G3WJU2 85%
Three-spined stickleback DKK1 antibody; Gasterosteus aculeatus DKK1 antibody G3P399 84%
Three-spined stickleback DKK2 antibody; Gasterosteus aculeatus DKK2 antibody G3PZT0 85%
Western clawed frog dkk1 antibody; Xenopus tropicalis dkk1 antibody F6YMT6 100%
Western clawed frog dkk1 antibody; Xenopus tropicalis dkk1 antibody A9ULN0 100%
Western clawed frog LOC100493182 antibody; Xenopus tropicalis LOC100493182 antibody F6PVN8 85%
White-tufted-ear marmoset LOC100387662 antibody; Callithrix jacchus LOC100387662 antibody F7IQ87 100%
White-tufted-ear marmoset LOC100401841 antibody; Callithrix jacchus LOC100401841 antibody F7IRM5 85%
Zebra finch DKK1 antibody; Taeniopygia guttata DKK1 antibody H1A1H7 85%
Zebra finch DKK2 antibody; Taeniopygia guttata DKK2 antibody H0Z0F7 85%
Zebrafish DKEY-84C11.2 antibody; Danio rerio DKEY-84C11.2 antibody B8JIZ2 85%
Zebrafish dkk1a antibody; Danio rerio dkk1a antibody F1RBK0 85%
Zebrafish dkk1b antibody; Danio rerio dkk1b antibody Q9W6D9 85%
Zebrafish dkk1b antibody; Danio rerio dkk1b antibody Q9PWH3 85%
Zebrafish dkk1b antibody; Danio rerio dkk1b antibody Q08CR4 85%
Zebrafish dkk1b antibody; Danio rerio dkk1b antibody F1QAX3 85%
Zebrafish dkk2 antibody; Danio rerio dkk2 antibody A8KB56 85%

Product Protocols: DKK1 antibody tested with Human Hepg2 Cells (ARP48015_T100)

Aviva Systems Biology is the original manufacturer of this DKK1 antibody (ARP48015_T100)

Click here to view the DKK1 antibody Western Blot Protocol

Product Datasheet Link: DKK1 antibody (ARP48015_T100)

WB Suggested Anti-DKK1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s DKK1 antibody (ARP48015_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review:DKK1 antibody-C-terminal region (ARP48015_T100) in human PLC/PRF5 cell lysate using Western blot

Product Page for DKK1 antibody-C-terminal region (ARP48015_T100)

Researcher:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong
Application:Western blotting
Species+tissue/cell type: Lane 1: 30ug human PLC/PRF5 cell lysate Lane 2: 30ug DKK1 PLC/PRF5 cell lysate
Primary antibody dilution:1:1000
Secondary antibody:Anti-rabbit-HRP
Secondary antibody dilution:1:10,000

Questionnaire:
Would you use this antibody in future experiments? Under consideration.
Have you used another antibody which has worked in your application? Yes.
How did you store the antibody after re-suspension? 4 degree Celsius
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human Liver Cancer Cell Lines; 30 ug per lane
How many different experimental trials were conducted using the antibody sample? Once
How was this sample prepared? As same as the protocol provided by Aviva Systems Biology.
Primary antibody dilution and incubation time: 1:1000 overnight at 4 degree Celsius
Secondary antibody used and dilution and incubation time: 1:10000 1hour at room temperature
What controls were used in your experiment (positive/negative)? DKK1 overexpressing PLC/PRF/5 cell line
Please include your detailed WB Procedure/Protocol here: As same as the protocol provided by Aviva Systems Biology.
 
X
Ask a Question