- Description of Target:
- The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
- Gene Symbol:
- BMP7
- Official Gene Full Name:
- Bone morphogenetic protein 7
- Alias Symbols:
- OP-1
- Tissue Tool:
- Find tissues and cell lines supported to express BMP7.
- Protein Accession# :
- NP_001710
- Nucleotide Accession#:
- NM_001719
- Swissprot Id:
- P18075
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 431
- Molecular Weight:
- 49kDa
- Application:
- WB, IHC
- Partner Proteins:
- DACH1, SIX1, SIX2, SIX4, SIX5, SIX5
- Immunogen:
- The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- BMP7 antibody - N-terminal region (ARP32329_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Horse: 90%; Zebrafish: 81%; Chicken: 76%
- Datasheets / Downloads:
- Printable datasheet for
anti-BMP7 antibody
- ARP32329_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
- Blocking Peptide:
- For anti-BMP7 antibody is Catalog # AAP32329 (Previous Catalog # AAPP03316)
- Key Reference:
- Gregory,K.E., (2005) J. Biol. Chem. 280 (30), 27970-27980
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-BMP7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: BMP7 antibody tested with Human Transfected 293T Cells (ARP32329_T100)
Aviva Systems Biology is the original manufacturer of this BMP7 antibody (ARP32329_T100)
Click here to view the BMP7 antibody Western Blot Protocol
Product Datasheet Link: BMP7 antibody (ARP32329_T100)
WB Suggested Anti-BMP7 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s BMP7 antibody (ARP32329_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: BMP7 antibody tested by IHC with human kidney (ARP32329)
Aviva Systems Biology is the original manufacturer of this BMP7 antibody.
Click here to view the BMP7 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: BMP7 antibody (ARP32329)
IHC Information:
Rabbit Anti-BMP7 Antibody
Catalog Number: ARP32329
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
