website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GAS7 antibody - N-terminal region (ARP30004_T100)

Description of Target:
The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.
Gene Symbol:
Official Gene Full Name:
Growth arrest-specific 7
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express GAS7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Growth arrest-specific protein 7
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
GAS7 antibody - N-terminal region (ARP30004_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Species Reactivity:
Human, Bovine, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GAS7 antibody
- ARP30004_T100
Peptide Sequence:
Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Blocking Peptide:
For anti-GAS7 antibody is Catalog # AAP30004 (Previous Catalog # AAPH00104)
Target Reference:
Ju,Y.T., et al., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (19), 11423-11428
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GAS7 antibody (ARP30004)

Product page for GAS7 antibody (ARP30004)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant GAS7 antibody; Loxodonta africana GAS7 antibody G3TH50 76%
Bovine Gas7 antibody; Bos taurus Gas7 antibody C9EH46 100%
Dog GAS7 antibody; Canis familiaris GAS7 antibody F1PQV0 100%
Guinea pig GAS7 antibody; Cavia porcellus GAS7 antibody H0UZE6 100%
Horse GAS7 antibody; Equus caballus GAS7 antibody F6VTT9 100%
Horse GAS7 antibody; Equus caballus GAS7 antibody F6VMR5 100%
Human GAS7 antibody; Homo sapiens GAS7 antibody O60861 100%
Human GAS7 antibody; Homo sapiens GAS7 antibody O60861-1 100%
Human GAS7 antibody; Homo sapiens GAS7 antibody Q59GS9 100%
Human GAS7 antibody; Homo sapiens GAS7 antibody H0Y751 100%
Human GAS7 antibody; Homo sapiens GAS7 antibody F5H2K0 100%
Human GAS7 antibody; Homo sapiens GAS7 antibody A8KAC2 100%
Human MLL/GAS7 antibody; Homo sapiens MLL/GAS7 antibody A2JNH2 100%
Human MLL/GAS7 antibody; Homo sapiens MLL/GAS7 antibody A2JNH1 100%
Human MLL/GAS7 antibody; Homo sapiens MLL/GAS7 antibody A2JNH3 92%
Little brown bat GAS7 antibody; Myotis lucifugus GAS7 antibody G1PC30 92%
Lowland gorilla GAS7 antibody; Gorilla gorilla gorilla GAS7 antibody G3RWT2 100%
Lowland gorilla GAS7 antibody; Gorilla gorilla gorilla GAS7 antibody G3RAZ3 100%
Mouse GAS7 antibody; Mus musculus GAS7 antibody Q60780 92%
Mouse Gas7 antibody; Mus musculus Gas7 antibody Q3U432 92%
Mouse Gas7 antibody; Mus musculus Gas7 antibody Q0VBR8 92%
Mouse Gas7 antibody; Mus musculus Gas7 antibody B1ATI9 92%
Mouse Gas7 antibody; Mus musculus Gas7 antibody Q3U8N2 91%
Northern white-cheeked gibbon GAS7 antibody; Nomascus leucogenys GAS7 antibody G1RGJ5 100%
Rabbit GAS7 antibody; Oryctolagus cuniculus GAS7 antibody G1T0F0 100%
Rat Gas7 antibody; Rattus norvegicus Gas7 antibody F1LR44 92%
Rat GAS7 antibody; Rattus norvegicus GAS7 antibody O55148 92%
Rhesus macaque GAS7 antibody; Macaca mulatta GAS7 antibody F7EG47 85%
Small-eared galago GAS7 antibody; Otolemur garnettii GAS7 antibody H0WHM5 100%
White-tufted-ear marmoset GAS7 antibody; Callithrix jacchus GAS7 antibody F7IQ92 100%
White-tufted-ear marmoset GAS7 antibody; Callithrix jacchus GAS7 antibody F7IQ09 100%
White-tufted-ear marmoset GAS7 antibody; Callithrix jacchus GAS7 antibody F7IJX0 100%
White-tufted-ear marmoset GAS7 antibody; Callithrix jacchus GAS7 antibody F6WN67 100%

Product Protocols: GAS7 antibody tested with Human Fetal Cerebellum Tissue (ARP30004_T100)

Aviva Systems Biology is the original manufacturer of this GAS7 antibody (ARP30004_T100)

Click here to view the GAS7 antibody Western Blot Protocol

Product Datasheet Link: GAS7 antibody (ARP30004_T100)

WB Suggested Anti-GAS7 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal cerebellum

Western Blot image:

Description of Target: The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GAS7 antibody (ARP30004_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: GAS7 antibody tested by IHC with human muscle (ARP30004)

Aviva Systems Biology is the original manufacturer of this GAS7 antibody.

Click here to view the GAS7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GAS7 antibody (ARP30004)

IHC Information:

Rabbit Anti-GAS7 Antibody
Catalog Number: ARP30004
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question