website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GAS7 antibody - N-terminal region (ARP30004_T100)

Description of Target:
The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.
Gene Symbol:
Official Gene Full Name:
Growth arrest-specific 7
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GAS7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GAS7.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Growth arrest-specific protein 7
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the N terminal region of human GAS7
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
Anti-GAS7 (ARP30004_T100)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-GAS7 (ARP30004_T100) antibody
Peptide Sequence:
Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Blocking Peptide:
For anti-GAS7 (ARP30004_T100) antibody is Catalog # AAP30004 (Previous Catalog # AAPH00104)
Target Reference:
Ju,Y.T., et al., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (19), 11423-11428
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GAS7 antibody tested with Human Fetal Cerebellum Tissue (ARP30004_T100)

Aviva Systems Biology is the original manufacturer of this GAS7 antibody (ARP30004_T100)

Click here to view the GAS7 antibody Western Blot Protocol

Product Datasheet Link: GAS7 antibody (ARP30004_T100)

WB Suggested Anti-GAS7 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal cerebellum

Western Blot image:

Description of Target: The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GAS7 antibody (ARP30004_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: GAS7 antibody tested by IHC with human muscle (ARP30004)

Aviva Systems Biology is the original manufacturer of this GAS7 antibody.

Click here to view the GAS7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GAS7 antibody (ARP30004)

IHC Information:

Rabbit Anti-GAS7 Antibody
Catalog Number: ARP30004
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question