website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/30/2016.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


lab antibody - N-terminal region (ARP47876_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Swissprot Id:
    Protein Accession #:
    Alias Symbols:
    Dmel_CG1264, BG:DS00004.9, CG1264, DmLab, EfR9, F121, F24, F90, F90-2, l(3)01241, l(3)84Ac, lb, Dm lab, Dmel\CG1264, Dmlab, Lab
    Description of Target:
    lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express lab.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express lab.
    The immunogen is a synthetic peptide corresponding to a region of Fruit fly
    Predicted Homology Based on Immunogen Sequence:
    Fruit fly:100%;
    Complete computational species homology data:
    Anti-lab (ARP47876_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Abd-B; abd-A; Ubx; Antp; Scr; Dfd; pb;
    Blocking Peptide:
    For anti-lab (ARP47876_P050) antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320)
    Datasheets / Downloads:
    Printable datasheet for anti-lab (ARP47876_P050) antibody

    Product Protocols: lab antibody tested with Human Drosophila (ARP47876_P050)

    Aviva Systems Biology is the original manufacturer of this lab antibody (ARP47876_P050)

    Click here to view the lab antibody Western Blot Protocol

    Product Datasheet Link: lab antibody (ARP47876_P050)

    WB Suggested Anti-lab Antibody Titration: 0.2-1 ug/ml
    Positive Control: Drosophila

    Western Blot image:

    Description of Target: lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s lab antibody (ARP47876_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Protocols: lab antibody tested by IHC with human kidney (ARP47876)

    Aviva Systems Biology is the original manufacturer of this lab antibody.

    Click here to view the lab antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: lab antibody (ARP47876)

    IHC Information:

    Rabbit Anti-lab Antibody
    Catalog Number: ARP47876
    Paraffin Embedded Tissue: Human Kidney
    Cellular Data: Epithelial cells of renal tubule
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Ask a Question