website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

lab antibody - N-terminal region (ARP47876_P050)

Description of Target:
lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Dmel_CG1264; BG:DS00004.9; CG1264; DmLab; EfR9; F121; F24; F90; F90-2; l(3)01241; l(3)84Ac; lb; Dm lab; Dmel\CG1264; Dmlab; Lab
Tissue Tool:
Find tissues and cell lines supported to express lab.
Protein Accession #:
Swissprot Id:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Gap1, H, MED17, Scr, d, ey, eyg, lab, skd
The immunogen for anti-lab antibody: synthetic peptide corresponding to a region of Fruit fly
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
lab antibody - N-terminal region (ARP47876_P050)
Predicted Homology Based on Immunogen Sequence:
Fruit fly:100%; 
Datasheets / Downloads:
Printable datasheet for
anti-lab antibody
- ARP47876_P050
Peptide Sequence:
Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
Blocking Peptide:
For anti-lab antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-lab antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question