website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

lab antibody - N-terminal region (ARP47876_P050)

Description of Target:
lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Dmel_CG1264; BG:DS00004.9; CG1264; DmLab; EfR9; F121; F24; F90; F90-2; l(3)01241; l(3)84Ac; lb; Dm lab; Dmel\CG1264; Dmlab; Lab
Tissue Tool:
Find tissues and cell lines supported to express lab.
Protein Accession #:
Swissprot Id:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Gap1, H, MED17, Scr, d, ey, eyg, lab, skd
The immunogen for anti-lab antibody: synthetic peptide corresponding to a region of Fruit fly
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
lab antibody - N-terminal region (ARP47876_P050)
Predicted Homology Based on Immunogen Sequence:
Fruit fly:100%; 
Datasheets / Downloads:
Printable datasheet for
anti-lab antibody
- ARP47876_P050
Peptide Sequence:
Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
Blocking Peptide:
For anti-lab antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-lab antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for lab antibody (ARP47876)

Product page for lab antibody (ARP47876)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Fruit fly DanaGF17803 antibody; Drosophila ananassae DanaGF17803 antibody B3M0R9 85%
Fruit fly DereGG10324 antibody; Drosophila erecta DereGG10324 antibody B3P2P0 100%
Fruit fly DperGL22053 antibody; Drosophila persimilis DperGL22053 antibody B4GEP4 85%
Fruit fly Dpselab antibody; Drosophila pseudoobscura pseudoobscura Dpselab antibody B5DXF1 85%
Fruit fly DsimGD19532 antibody; Drosophila simulans DsimGD19532 antibody B4QYE0 100%
Fruit fly DyakGE25839 antibody; Drosophila yakuba DyakGE25839 antibody B4PSJ9 100%
Fruit fly LAB antibody; Drosophila melanogaster LAB antibody P10105 100%
Fruit fly LAB antibody; Drosophila melanogaster LAB antibody P10105-2 100%

Product Protocols: lab antibody tested with Human Drosophila (ARP47876_P050)

Aviva Systems Biology is the original manufacturer of this lab antibody (ARP47876_P050)

Click here to view the lab antibody Western Blot Protocol

Product Datasheet Link: lab antibody (ARP47876_P050)

WB Suggested Anti-lab Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila

Western Blot image:

Description of Target: lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s lab antibody (ARP47876_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question