website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

lab antibody - N-terminal region (ARP47876_P050)

Description of Target:
lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Dmel_CG1264; BG:DS00004.9; CG1264; DmLab; EfR9; F121; F24; F90; F90-2; l(3)01241; l(3)84Ac; lb; Dm lab; Dmel\CG1264; Dmlab; Lab
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express lab.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express lab.
Swissprot Id:
Protein Accession #:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
Abd-B; abd-A; Ubx; Antp; Scr; Dfd; pb;
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-lab (ARP47876_P050)
Predicted Homology Based on Immunogen Sequence:
Fruit fly:100%;
Datasheets / Downloads:
Printable datasheet for anti-lab (ARP47876_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
Blocking Peptide:
For anti-lab (ARP47876_P050) antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: lab antibody tested with Human Drosophila (ARP47876_P050)

Aviva Systems Biology is the original manufacturer of this lab antibody (ARP47876_P050)

Click here to view the lab antibody Western Blot Protocol

Product Datasheet Link: lab antibody (ARP47876_P050)

WB Suggested Anti-lab Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila

Western Blot image:

Description of Target: lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s lab antibody (ARP47876_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question