- Description of Target:
- Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.
- Gene Symbol:
- pb
- Official Gene Full Name:
- Proboscipedia
- Alias Symbols:
- Dmel_CG31481; CG31481; PB; l(3)04498; pd; BG:DS01719.1; CG17880; Dmel\CG31481; Dmpb; Pb
- Tissue Tool:
- Find tissues and cell lines supported to express pb.
- Protein Accession# :
- NP_996163
- Nucleotide Accession#:
- NM_206441
- Swissprot Id:
- P31264
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 777
- Molecular Weight:
- 83kDa
- Application:
- WB
- Partner Proteins:
- CG15120, CG16985, CG4623, Cpr73D, CycE, Dfd, Dsp1, Pc, Pcl, Scr, Snr1, Ubx, Zasp66, ash2, brm, d, ey, hth, lab, mor, osa, spen, tna, trx
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- pb antibody - middle region (ARP47877_P050)
- Predicted Homology Based on Immunogen Sequence:
- Fruit fly:100%;
- Datasheets / Downloads:
- Printable datasheet for
anti-pb antibody
- ARP47877_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK
- Blocking Peptide:
- For anti-pb antibody is Catalog # AAP47877 (Previous Catalog # AAPP27321)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-pb antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: pb antibody tested with Human Drosophila (ARP47877_P050)
Aviva Systems Biology is the original manufacturer of this pb antibody (ARP47877_P050)
Click here to view the pb antibody Western Blot Protocol
Product Datasheet Link: pb antibody (ARP47877_P050)
WB Suggested Anti-pb Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila
Western Blot image: 
Description of Target: Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s pb antibody (ARP47877_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
