DYRK1A antibody - N-terminal region (ARP45797_P050)

Catalog#: ARP45797_P050

• Size: 50ug

Human ACHN

• Description of Target: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.
• Gene Symbol: DYRK1A
• Official Gene Full Name: Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
• Alias Symbols: DYRK; DYRK1; HP86; MNB; MNBH; MRD7
• Protein Accession#: NP_001387
• Nucleotide Accession#: NM_001396
• Swissprot Id: Q13627
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 763
• Molecular Weight: 85kDa
• Application: WB
• Partner Proteins: CREB1, PHYHIP, CCNL2, CREB1, DYRK1A, FOXO1, GLI1, PHYHIP, SF3B1, YWHAB, YWHAE, YWHAG, CCNL2, DCAF7, DNM1, SFN, SFRS16, SRSF1, SRSF4, SRSF5
• Immunogen: The immunogen for anti-DYRK1A antibody: synthetic peptide directed towards the N terminal of human DYRK1A
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM
• Blocking Peptide: For anti-DYRK1A antibody is Catalog # AAP45797 (Previous Catalog # AAPP26741)
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-DYRK1A antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: DYRK1A antibody tested with Human Achn Cells (ARP45797_P050)

Aviva Systems Biology is the original manufacturer of this DYRK1A antibody (ARP45797_P050)

Click here to view the DYRK1A antibody Western Blot Protocol

Product Datasheet Link: DYRK1A antibody (ARP45797_P050)

WB Suggested Anti-DYRK1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN

Western Blot image:


Description of Target: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s DYRK1A antibody (ARP45797_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com