website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Dnmt1 antibody - N-terminal region (ARP37033_P050)

Description of Target:
Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
Gene Symbol:
Official Gene Full Name:
DNA methyltransferase (cytosine-5) 1
NCBI Gene Id:
Alias Symbols:
Cxxc9; Dnmt; Dnmt1o; MTase; Met-1; Met1; MommeD2; MCMT; m.MmuI
Tissue Tool:
Find tissues and cell lines supported to express Dnmt1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
DNA (cytosine-5)-methyltransferase 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-Dnmt1 antibody: synthetic peptide directed towards the N terminal of mouse Dnmt1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
Dnmt1 antibody - N-terminal region (ARP37033_P050)
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-Dnmt1 antibody
- ARP37033_P050
Peptide Sequence:
Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
Blocking Peptide:
For anti-Dnmt1 antibody is Catalog # AAP37033 (Previous Catalog # AAPP09231)
Key Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Dnmt1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question