website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Dnmt1 antibody - N-terminal region (ARP37033_P050)

Description of Target:
Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
Gene Symbol:
Official Gene Full Name:
DNA methyltransferase (cytosine-5) 1
NCBI Gene Id:
Alias Symbols:
Cxxc9; Dnmt; Dnmt1o; MTase; Met-1; Met1; MommeD2; MCMT; m.MmuI
Tissue Tool:
Find tissues and cell lines supported to express Dnmt1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
DNA (cytosine-5)-methyltransferase 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-Dnmt1 antibody: synthetic peptide directed towards the N terminal of mouse Dnmt1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
Dnmt1 antibody - N-terminal region (ARP37033_P050)
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-Dnmt1 antibody
- ARP37033_P050
Peptide Sequence:
Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
Blocking Peptide:
For anti-Dnmt1 antibody is Catalog # AAP37033 (Previous Catalog # AAPP09231)
Target Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Dnmt1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Dnmt1 antibody (ARP37033)

Product page for Dnmt1 antibody (ARP37033)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Mouse DNMT1 antibody; Mus musculus DNMT1 antibody P13864 100%
Mouse DNMT1 antibody; Mus musculus DNMT1 antibody P13864-2 100%
Mouse Dnmt1 antibody; Mus musculus Dnmt1 antibody Q7TSJ0 100%
Mouse Dnmt1 antibody; Mus musculus Dnmt1 antibody Q3UWN4 100%
Mouse Dnmt1 antibody; Mus musculus Dnmt1 antibody Q3UPE8 100%
Mouse Dnmt1 antibody; Mus musculus Dnmt1 antibody Q3UHZ3 100%

Product Protocols: Dnmt1 antibody tested with Human Mouse Lung Tissue (ARP37033_P050)

Aviva Systems Biology is the original manufacturer of this Dnmt1 antibody (ARP37033_P050)

Click here to view the Dnmt1 antibody Western Blot Protocol

Product Datasheet Link: Dnmt1 antibody (ARP37033_P050)

WB Suggested Anti-Dnmt1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Lung

Western Blot image:

Description of Target: Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Dnmt1 antibody (ARP37033_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review:Dnmt1 antibody-N-terminal region (ARP37033_P050) in WT mouse ES lysate and DNMT1 KO mouse ES lysate using Western blot

Product Page for Dnmt1 antibody-N-terminal region (ARP37033_P050)

Researcher:Austin J. Cooney, Baylor College of Medicine
Application:Western blotting
Species+tissue/cell type: Lane 1: 15ug WT mouse ES lysate Lane 2: 15ug DNMT1 KO mouse ES lysate
Primary antibody dilution:1:1000
Secondary antibody:Goat anti-rabbit-HRP
Secondary antibody dilution:1:2500

Product Review: Dnmt1 antibody - N-terminal region (ARP37033_P050) in mouse mesenchymal stem cell lysate using Western Blot

Product Page for Dnmt1 antibody - N-terminal region (ARP37033_P050)

Researcher: Anonymous
Application: Western Blotting
Species+tissue/cell type: Lane 1: 20ug mouse mesenchymal stem cell lysate
Primary antibody dilution: 1:2000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:10,000


How do Aviva’s reagents play a role in your experimental goals? Gene expression
How would you rate this antibody on a scale from 1-5 (5=best) nad why? 4
Would you use this antibody in future experiment? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva’s website is correct? Yes
How did you store the antibody after re-suspension? -20
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Mouse, mesenchymal stem cell, 20 microgram
How many different experimental trials were conducted using the antibody sample? 1
How was this sample prepared? Primary isolated from mouse long bone marrow and culture under standard osteogenic induction condition.
Primary antibody dilution and incubation time: 1:2000, overnight
Secondary antibody used and dilution and incubation time: 1:10000, 1 hour
What controls were used in your experiment (positive/negative)? MSC after osteogenic induction for positive control
Please include your detailed WB Procedure/Protocol here: Cells were lysed in M-PER mammalian protein extraction reagent (Thermo) with protease and phosphatase inhibitors (Roche), and proteins were quantified using protein concentration assay (Bio-Rad Laboratories). 20 μg of proteins were separated by SDS-PAGE and transferred to 0.2 μm nitrocellulose membranes (Millipore). The membranes were blocked with 5% non-fat dry milk and 0.1% Tween-20 for 1 hour, followed by incubation overnight with the primary antibodies diluted in blocking solution. The membranes were then incubated for 1 h in HRP-conjugated secondary antibody (Santa Cruz) diluted at 1:10,000 in blocking solution. Immunoreactive proteins were detected using SuperSignal® West Pico Chemiluminescent Substrate (Thermo) and BioMax film (Kodak).
Ask a Question