- Description of Target:
- NFIB is a member of the nuclear factor I family of nuclear proteins, which are known to be involved in viral and cellular transcription. NFIB includes the proposed DNA binding and dimerization domain. NFIB recognizes and binds the palindromic sequence 5'-
- Gene Symbol:
- NFIB
- Official Gene Full Name:
- Nuclear factor I/B
- Alias Symbols:
- CTF; NF1-B; NFI-B; NFIB2; NFIB3; NF-I/B; NFI-RED; HMGIC/NFIB
- Tissue Tool:
- Find tissues and cell lines supported to express NFIB.
- Protein Accession# :
- NP_005587
- Nucleotide Accession#:
- NM_005596
- Swissprot Id:
- O00712
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 420
- Molecular Weight:
- 47kDa
- Application:
- WB
- Partner Proteins:
- NFIB, NFIX, PIR, RFX1, SKI, HDAC1, NFIB, PIR, RB1, RFX1, SKI
- Immunogen:
- The immunogen for anti-NFIB antibody: synthetic peptide directed towards the middle region of human NFIB
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- NFIB antibody - middle region (ARP32716_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-NFIB antibody
- ARP32716_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
- Blocking Peptide:
- For anti-NFIB antibody is Catalog # AAP32716 (Previous Catalog # AAPP03730)
- Key Reference:
- Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-NFIB antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: NFIB antibody tested with Human Transfected 293T Cells (ARP32716_T100)
Aviva Systems Biology is the original manufacturer of this NFIB antibody (ARP32716_T100)
Click here to view the NFIB antibody Western Blot Protocol
Product Datasheet Link: NFIB antibody (ARP32716_T100)
WB Suggested Anti-NFIB Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: NFIB is a member of the nuclear factor I family of nuclear proteins, which are known to be involved in viral and cellular transcription. NFIB includes the proposed DNA binding and dimerization domain. NFIB recognizes and binds the palindromic sequence 5'-
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s NFIB antibody (ARP32716_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
