- Description of Target:
- NCR1 is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
- Gene Symbol:
- NCR1
- Official Gene Full Name:
- Natural cytotoxicity triggering receptor 1
- Alias Symbols:
- CD335; FLJ99094; LY94; NK-p46; NKP46
- Tissue Tool:
- Find tissues and cell lines supported to express NCR1.
- Protein Accession# :
- NP_004820
- Nucleotide Accession#:
- NM_004829
- Swissprot Id:
- O76036
- Host:
- Rabbit
- Protein Size (# AA):
- 304
- Molecular Weight:
- 33kDa
- Application:
- WB
- Partner Proteins:
- CD247,CD59,FCER1G,CD247,CD59,PHF1
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- NCR1 antibody - N-terminal region (ARP63659_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-NCR1 antibody
- ARP63659_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: AVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
- Blocking Peptide:
- For anti-NCR1 antibody is Catalog # AAP63659
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-NCR1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
