website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

KIF23 antibody - N-terminal region (ARP33963_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Gene Symbol:
KIF23
Official Gene Full Name:
Kinesin family member 23
NCBI Gene Id:
9493
Alias Symbols:
CHO1; KNSL5; MKLP1; MKLP-1
Tissue Tool:
Find tissues and cell lines supported to express KIF23.
Protein Accession #:
NP_004847
Nucleotide Accession#:
NM_004856
Swissprot Id:
Q02241
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Kinesin-like protein KIF23
Protein Size (# AA):
856
Molecular Weight:
98kDa
Application:
WB
Protein Interactions:
UBC; YWHAQ; YWHAE; RACGAP1; XRCC6; IKBKG; SIRT7; SH3KBP1; SUMO2; Kif23; Dctn2; Shcbp1; Cd2ap; YWHAZ; YWHAH; YWHAG; YWHAB; STK11; CENPA; PRC1; FYCO1; PLK1; ARF3; ACTA1; BIRC6; USP8; PKLR; SFN;
Immunogen:
The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the N terminal of human KIF23
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
KIF23 antibody - N-terminal region (ARP33963_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 92%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%
Species Reactivity:
Human, Rabbit, Bovine, Rat, Mouse, Horse
Datasheets / Downloads:
Printable datasheet for
anti-KIF23 antibody
- ARP33963_T100
Peptide Sequence:
Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Blocking Peptide:
For anti-KIF23 antibody is Catalog # AAP33963 (Previous Catalog # AAPP05038)
Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: KIF23 antibody tested with Human Jurkat Cells (ARP33963_T100)

Aviva Systems Biology is the original manufacturer of this KIF23 antibody (ARP33963_T100)

Click here to view the KIF23 antibody Western Blot Protocol

Product Datasheet Link: KIF23 antibody (ARP33963_T100)

WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s KIF23 antibody (ARP33963_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question