website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

KIF23 antibody - N-terminal region (ARP33963_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Gene Symbol:
KIF23
Official Gene Full Name:
Kinesin family member 23
NCBI Gene Id:
9493
Alias Symbols:
CHO1; KNSL5; MKLP1; MKLP-1
Tissue Tool:
Find tissues and cell lines supported to express KIF23.
Protein Accession #:
NP_004847
Nucleotide Accession#:
NM_004856
Swissprot Id:
Q02241
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Kinesin-like protein KIF23
Protein Size (# AA):
856
Molecular Weight:
98kDa
Application:
WB
Immunogen:
The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the N terminal of human KIF23
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
KIF23 antibody - N-terminal region (ARP33963_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 92%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%
Species Reactivity:
Human, Rabbit, Bovine, Rat, Mouse, Horse
Datasheets / Downloads:
Printable datasheet for
anti-KIF23 antibody
- ARP33963_T100
Peptide Sequence:
Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Blocking Peptide:
For anti-KIF23 antibody is Catalog # AAP33963 (Previous Catalog # AAPP05038)
Key Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-KIF23 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question