website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

KIF23 antibody - N-terminal region (ARP33963_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Gene Symbol:
Official Gene Full Name:
Kinesin family member 23
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express KIF23.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Kinesin-like protein KIF23
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the N terminal of human KIF23
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
KIF23 antibody - N-terminal region (ARP33963_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 92%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%
Species Reactivity:
Human, Rabbit, Bovine, Rat, Mouse, Horse
Datasheets / Downloads:
Printable datasheet for
anti-KIF23 antibody
- ARP33963_T100
Peptide Sequence:
Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Blocking Peptide:
For anti-KIF23 antibody is Catalog # AAP33963 (Previous Catalog # AAPP05038)
Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-KIF23 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for KIF23 antibody (ARP33963)

Product page for KIF23 antibody (ARP33963)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant KIF23 antibody; Loxodonta africana KIF23 antibody G3SMC8 92%
Bovine KIF23 antibody; Bos taurus KIF23 antibody A5D7N6 84%
Chinese hamster Kif23 antibody; Cricetulus griseus Kif23 antibody Q60442 84%
Horse KIF23 antibody; Equus caballus KIF23 antibody F7D2K6 84%
Horse KIF23 antibody; Equus caballus KIF23 antibody F7CXF0 84%
Human KIF23 antibody; Homo sapiens KIF23 antibody Q02241 100%
Human KIF23 antibody; Homo sapiens KIF23 antibody Q02241-2 100%
Human KIF23 antibody; Homo sapiens KIF23 antibody H0YME6 100%
Lowland gorilla KIF23 antibody; Gorilla gorilla gorilla KIF23 antibody G3QN02 100%
Mouse Kif23 antibody; Mus musculus Kif23 antibody Q9CXV7 84%
Mouse Kif23 antibody; Mus musculus Kif23 antibody Q80V30 84%
Mouse Kif23 antibody; Mus musculus Kif23 antibody Q05DU6 84%
Mouse Kif23 antibody; Mus musculus Kif23 antibody F6XCV8 84%
Mouse Kif23 antibody; Mus musculus Kif23 antibody E9Q5W8 84%
Mouse Kif23 antibody; Mus musculus Kif23 antibody E9Q5G3 84%
Northern white-cheeked gibbon KIF23 antibody; Nomascus leucogenys KIF23 antibody G1RT23 92%
Rabbit KIF23 antibody; Oryctolagus cuniculus KIF23 antibody G1T8N9 92%
Rat Kif23 antibody; Rattus norvegicus Kif23 antibody F1LZY1 84%
Rat Kif23 antibody; Rattus norvegicus Kif23 antibody D4AAG4 84%
Rhesus macaque KIF23 antibody; Macaca mulatta KIF23 antibody F6TQ65 92%
Small-eared galago KIF23 antibody; Otolemur garnettii KIF23 antibody H0XXS1 92%

Product Protocols: KIF23 antibody tested with Human Jurkat Cells (ARP33963_T100)

Aviva Systems Biology is the original manufacturer of this KIF23 antibody (ARP33963_T100)

Click here to view the KIF23 antibody Western Blot Protocol

Product Datasheet Link: KIF23 antibody (ARP33963_T100)

WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s KIF23 antibody (ARP33963_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question