BAX antibody - N-terminal region (AVARP02020_T100)

Catalog#: AVARP02020_T100

• Size: 100ug

Human HepG2

Human NT-2 and Mouse WT brain

Human, Mouse, Rat

Human kidney

• Description of Target: BAX encodes a protein that belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. BAX expression is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.
• Gene Symbol: BAX
• Official Gene Full Name: BCL2-associated X protein
• Alias Symbols: BCL2L4
• Protein Accession#: NP_620116
• Nucleotide Accession#: NM_138761
• Swissprot Id: Q07812
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 192
• Molecular Weight: 21kDa
• Application: WB, IHC
• Partner Proteins: BAK1, TP53, TP53, BAK1, BAX, BCL2, BCL2A1, BCL2L1, BCL2L10, BID, ERN1, HSPD1, MCL1, MFN1, TP53, VDAC1, VDAC2, ACTR2, AKAP13, BAK1, BAX, BCL2, BCL2L1, BCL2L2, DFFA, FBL, FRYL, HSPD1, KRT31, MCL1, MYCBP2, SRRM2, TP53, VDAC2
• Immunogen: The immunogen for anti-BAX antibody: synthetic peptide directed towards the N terminal of human BAX
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Human: 100%; Pig: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
• Blocking Peptide: For anti-BAX antibody is Catalog # AAP30231 (Previous Catalog # AAPP00401)
• Key Reference: Yamaguchi,H., et al., (2004) J. Biol. Chem. 279 (38), 39431-39437
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-BAX antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: BAX antibody tested with Human Hepg2 Cells (AVARP02020_T100)

Aviva Systems Biology is the original manufacturer of this BAX antibody (AVARP02020_T100)

Click here to view the BAX antibody Western Blot Protocol

Product Datasheet Link: BAX antibody (AVARP02020_T100)

WB Suggested Anti-BAX Antibody Titration: 1.25ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: BAX encodes a protein that belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. BAX expression is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s BAX antibody (AVARP02020_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: BAX antibody tested by IHC with human kidney (AVARP02020)

Aviva Systems Biology is the original manufacturer of this BAX antibody.

Click here to view the BAX antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: BAX antibody (AVARP02020)

IHC Information:

Rabbit Anti-BAX Antibody
Catalog Number: AVARP02020
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Review: BAX antibody-N-terminal region (AVARP02020_T100) in Human NT-2 cells and Mouse WT brain using Western blot

Product Page for BAX antibody - N-terminal region (AVARP02020_T100)

Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application: Western blotting
Species+tissue/cell type: Human NT-2 cells and Mouse WT brain
How many ug’s of tissue/cell lysate run on the gel: 1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)
Primary antibody dilution: 2ug/ml
Secondary antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary antibody dilution: 1: 20,000