RNASEH2A antibody - middle region (ARP40647_T100)

Catalog#: ARP40647_T100

• Size: 100ug

Human Jurkat

Human Kidney

• Description of Target: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
• Gene Symbol: RNASEH2A
• Official Gene Full Name: Ribonuclease H2, subunit A
• Alias Symbols: AGS4; JUNB; RNHL; RNHIA; RNASEHI
• Protein Accession#: NP_006388
• Nucleotide Accession#: NM_006397
• Swissprot Id: O75792
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 299
• Molecular Weight: 33kDa
• Application: WB, IHC
• Subunit: A
• Partner Proteins: DHX9, SERPINB2, ABCA1, CD2BP2, EFTUD2, MEPCE, MYC, PRPF4, RNPS1, RNU11, RNU12-2P, SNRNP40, SNRPB, UBC, USP39
• Immunogen: The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the middle region of human RNASEH2A
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 100%; Zebrafish: 100%; African clawed frog: 92%; Mouse: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
• Blocking Peptide: For anti-RNASEH2A antibody is Catalog # AAP40647 (Previous Catalog # AAPP10624)
• Key Reference: Frank,P., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (22), 12872-12877
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-RNASEH2A antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: RNASEH2A antibody tested with Human Jurkat Cells (ARP40647_T100)

Aviva Systems Biology is the original manufacturer of this RNASEH2A antibody (ARP40647_T100)

Click here to view the RNASEH2A antibody Western Blot Protocol

Product Datasheet Link: RNASEH2A antibody (ARP40647_T100)

WB Suggested Anti-RNASEH2A Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RNASEH2A antibody (ARP40647_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: RNASEH2A antibody tested by IHC with human kidney (ARP40647)

Aviva Systems Biology is the original manufacturer of this RNASEH2A antibody.

Click here to view the RNASEH2A antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RNASEH2A antibody (ARP40647)

IHC Information:

Rabbit Anti-RNASEH2A Antibody
Catalog Number: ARP40647
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: