PA2G4 antibody - C-terminal region (ARP47601_P050)

Catalog#: ARP47601_P050

• Size: 50ug

Human HepG2

Human Lung

• Description of Target: PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: PA2G4
• Official Gene Full Name: Proliferation-associated 2G4, 38kDa
• Alias Symbols: EBP1; HG4-1; p38-2G4
• Protein Accession#: NP_006182
• Nucleotide Accession#: NM_006191
• Swissprot Id: Q9UQ80
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 394
• Molecular Weight: 44kDa
• Application: WB, IHC
• Partner Proteins: ERBB3, HDAC2, AR, ERBB3, EXOSC5, HDAC2, PRKCA, PRKCB, PRKCG, RB1, SIN3A, SUMO4, AR, ATR, ERBB3, HDAC2, MTOR, RB1, SGK1, USP39
• Immunogen: The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the C terminal of human PA2G4
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
• Blocking Peptide: For anti-PA2G4 antibody is Catalog # AAP47601 (Previous Catalog # AAPP28459)
• Key Reference: Okada,M., (2007) J. Biol. Chem. 282 (50), 36744-36754
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-PA2G4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: PA2G4 antibody tested with Human Hepg2 Cells (ARP47601_P050)

Aviva Systems Biology is the original manufacturer of this PA2G4 antibody (ARP47601_P050)

Click here to view the PA2G4 antibody Western Blot Protocol

Product Datasheet Link: PA2G4 antibody (ARP47601_P050)

WB Suggested Anti-PA2G4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PA2G4 antibody (ARP47601_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com