NCAPH antibody - C-terminal region (ARP46227_P050)

Catalog#: ARP46227_P050

• Size: 50ug

Human HepG2

• Description of Target: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
• Gene Symbol: NCAPH
• Official Gene Full Name: Non-SMC condensin I complex, subunit H
• Alias Symbols: BRRN1; CAP-H; HCAP-H
• Protein Accession#: NP_056156
• Nucleotide Accession#: NM_015341
• Swissprot Id: Q15003
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 741
• Molecular Weight: 82kDa
• Application: WB
• Subunit: 2
• Partner Proteins: CYTH2, CYTH1, CYTH2, CYTH3, CYTH4
• Immunogen: The immunogen for anti-NCAPH antibody: synthetic peptide directed towards the C terminal of human NCAPH
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 85%; Guinea pig: 85%; Horse: 78%
• Peptide Sequence: Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG
• Blocking Peptide: For anti-NCAPH antibody is Catalog # AAP46227 (Previous Catalog # AAPP27060)
• Key Reference: Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-NCAPH antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: NCAPH antibody tested with Human Hepg2 Cells (ARP46227_P050)

Aviva Systems Biology is the original manufacturer of this NCAPH antibody (ARP46227_P050)

Click here to view the NCAPH antibody Western Blot Protocol

Product Datasheet Link: NCAPH antibody (ARP46227_P050)

WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s NCAPH antibody (ARP46227_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com