- Description of Target:
- The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.
- Gene Symbol:
- KIF25
- Official Gene Full Name:
- Kinesin family member 25
- Alias Symbols:
- KNSL3; MGC163361
- Tissue Tool:
- Find tissues and cell lines supported to express KIF25.
- Protein Accession# :
- NP_005346
- Nucleotide Accession#:
- NM_005355
- Swissprot Id:
- Q9UIL4-2
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 332
- Molecular Weight:
- 35kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-KIF25 antibody: synthetic peptide directed towards the N terminal of human KIF25
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- KIF25 antibody - N-terminal region (ARP33973_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-KIF25 antibody
- ARP33973_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: YNVCVMAYGQTGSGKSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFR
- Blocking Peptide:
- For anti-KIF25 antibody is Catalog # AAP33973 (Previous Catalog # AAPP05048)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-KIF25 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: KIF25 antibody tested with Human Mcf7 Cells (ARP33973_P050)
Aviva Systems Biology is the original manufacturer of this KIF25 antibody (ARP33973_P050)
Click here to view the KIF25 antibody Western Blot Protocol
Product Datasheet Link: KIF25 antibody (ARP33973_P050)
WB Suggested Anti-KIF25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7
Western Blot image: 
Description of Target: The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s KIF25 antibody (ARP33973_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
