KIF23 antibody - N-terminal region (ARP33963_T100)

Catalog#: ARP33963_T100

• Size: 100ug

Human Jurkat

• Description of Target: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
• Gene Symbol: KIF23
• Official Gene Full Name: Kinesin family member 23
• Alias Symbols: CHO1; KNSL5; MKLP1; MKLP-1
• Protein Accession#: NP_004847
• Nucleotide Accession#: NM_004856
• Swissprot Id: Q02241
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 856
• Molecular Weight: 98kDa
• Application: WB
• Immunogen: The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the N terminal of human KIF23
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 92%; Bovine: 84%; Horse: 84%; Mouse: 84%; Rat: 84%
• Peptide Sequence: Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
• Blocking Peptide: For anti-KIF23 antibody is Catalog # AAP33963 (Previous Catalog # AAPP05038)
• Key Reference: Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-KIF23 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: KIF23 antibody tested with Human Jurkat Cells (ARP33963_T100)

Aviva Systems Biology is the original manufacturer of this KIF23 antibody (ARP33963_T100)

Click here to view the KIF23 antibody Western Blot Protocol

Product Datasheet Link: KIF23 antibody (ARP33963_T100)

WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s KIF23 antibody (ARP33963_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com