- Description of Target:
- APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Gene Symbol:
- APP
- Official Gene Full Name:
- Amyloid beta (A4) precursor protein
- Alias Symbols:
- AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN2; PN-II
- Tissue Tool:
- Find tissues and cell lines supported to express APP.
- Protein Accession# :
- NP_000475
- Nucleotide Accession#:
- NM_000484
- Swissprot Id:
- P05067
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 770
- Molecular Weight:
- 85kDa
- Application:
- WB
- Partner Proteins:
- MAPK3, CD3E, CSNK2B, HDAC1, MAPK3, SUMO1, TOP2A, TOP2B, TOPBP1, TP53, XPO1, XRCC5, BAZ1B, CD3E, CSNK2B, HDAC1, HDAC2, MTA2, SUMO1, TOP2A, TOPBP1, TP53
- Immunogen:
- The immunogen for anti-APP antibody: synthetic peptide directed towards the middle region of human APP
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- APP antibody - middle region (ARP33075_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-APP antibody
- ARP33075_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
- Blocking Peptide:
- For anti-APP antibody is Catalog # AAP33075 (Previous Catalog # AAPP04108)
- Key Reference:
- Locascio,J.J., (2008) Arch. Neurol. 65 (6), 776-785
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-APP antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: APP antibody tested with Human Fetal Heart Tissue (ARP33075_P050)
Aviva Systems Biology is the original manufacturer of this APP antibody (ARP33075_P050)
Click here to view the APP antibody Western Blot Protocol
Product Datasheet Link: APP antibody (ARP33075_P050)
WB Suggested Anti-APP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Fetal Heart
Western Blot image: 
Description of Target: APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s APP antibody (ARP33075_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
