website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CBX4 antibody - N-terminal region (ARP30002_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Gene Symbol:
Official Gene Full Name:
Chromobox homolog 4
NCBI Gene Id:
Alias Symbols:
PC2; NBP16
Sample Type Confirmation:

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CBX4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
E3 SUMO-protein ligase CBX4
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-CBX4 antibody: synthetic peptide directed towards the N terminal of human CBX4
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
CBX4 antibody - N-terminal region (ARP30002_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Species Reactivity:
Bovine, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-CBX4 antibody
- ARP30002_P050
Peptide Sequence:
Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Blocking Peptide:
For anti-CBX4 antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Key Reference:
Kagey,M.H., et al., (2003) Cell 113 (1), 127-137
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CBX4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question