website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/30/2016.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


CBX4 antibody - N-terminal region (ARP30002_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Chromobox homolog 4
    Protein Name:
    E3 SUMO-protein ligase CBX4
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    PC2, NBP16
    Description of Target:
    The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express CBX4.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express CBX4.
    The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
    Species Reactivity:
    Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
    Complete computational species homology data:
    Anti-CBX4 (ARP30002_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-CBX4 (ARP30002_P050) antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
    Datasheets / Downloads:
    Printable datasheet for anti-CBX4 (ARP30002_P050) antibody
    Sample Type Confirmation:

    CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

    Target Reference:
    Kagey,M.H., et al., (2003) Cell 113 (1), 127-137

    Hao, L., Midic, U., Garriga, J. & Latham, K. E. Contribution of CBX4 to cumulus oophorus cell phenotype in mice and attendant effects in cumulus cell cloned embryos. Physiol. Genomics 46, 66-80 (2014). WB, Bovine, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Mouse, Zebrafish 24280258

    Product Protocols: CBX4 antibody tested with Human Jurkat Cells (ARP30002_P050)

    Aviva Systems Biology is the original manufacturer of this CBX4 antibody (ARP30002_P050)

    Click here to view the CBX4 antibody Western Blot Protocol

    Product Datasheet Link: CBX4 antibody (ARP30002_P050)

    WB Suggested Anti-CBX4 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:1562500
    Positive Control: Jurkat

    Western Blot image:

    Description of Target: The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s CBX4 antibody (ARP30002_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Protocols: CBX4 antibody tested by IHC with human kidney (ARP30002)

    Aviva Systems Biology is the original manufacturer of this CBX4 antibody.

    Click here to view the CBX4 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: CBX4 antibody (ARP30002)

    IHC Information:

    Rabbit Anti-CBX 4 Antibody
    Catalog Number: ARP30002
    Paraffin Embedded Tissue: Human Kidney
    Cellular Data: Epithelial cells of renal tubule
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Ask a Question