website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

CBX4 antibody - N-terminal region (ARP30002_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Gene Symbol:
CBX4
Official Gene Full Name:
Chromobox homolog 4
NCBI Gene Id:
8535
Alias Symbols:
PC2; NBP16
Sample Type Confirmation:

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBX4.
Swissprot Id:
O00257-2
Protein Accession #:
NP_003646
Nucleotide Accession #:
NM_003655
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
E3 SUMO-protein ligase CBX4
Protein Size (# AA):
560
Molecular Weight:
61kDa
Application:
IHC, WB
Protein Interactions:
Rnf111; SUMO1; NEDD8; CBS; BMI1; EED; RNF2; HECW2; SOX2; YWHAE; YWHAB; CCDC158; DIS3L2; HIST4H4; CBX2; PARP12; RNF213; ZKSCAN7; DCAF6; KDM3A; MYCBP2; ANKRD26; PSME3; TRANK1; CBX4; HIST1H2AB; YWHAZ; SKIL; NPM1; HIST1H2BB; GTF2I; PHC2; CSNK2B; CSNK2A2; CSNK
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-CBX4 (ARP30002_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Species Reactivity:
Bovine, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-CBX4 (ARP30002_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Blocking Peptide:
For anti-CBX4 (ARP30002_P050) antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Target Reference:
Kagey,M.H., et al., (2003) Cell 113 (1), 127-137
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Publications:

Hao, L., Midic, U., Garriga, J. & Latham, K. E. Contribution of CBX4 to cumulus oophorus cell phenotype in mice and attendant effects in cumulus cell cloned embryos. Physiol. Genomics 46, 66-80 (2014). WB, Bovine, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Mouse, Zebrafish 24280258

Product Protocols: CBX4 antibody tested with Human Jurkat Cells (ARP30002_P050)

Aviva Systems Biology is the original manufacturer of this CBX4 antibody (ARP30002_P050)

Click here to view the CBX4 antibody Western Blot Protocol

Product Datasheet Link: CBX4 antibody (ARP30002_P050)

WB Suggested Anti-CBX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:


Description of Target: The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CBX4 antibody (ARP30002_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: CBX4 antibody tested by IHC with human kidney (ARP30002)

Aviva Systems Biology is the original manufacturer of this CBX4 antibody.

Click here to view the CBX4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CBX4 antibody (ARP30002)

IHC Information:

Rabbit Anti-CBX 4 Antibody
Catalog Number: ARP30002
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question