website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CBX4 antibody - N-terminal region (ARP30002_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Gene Symbol:
Official Gene Full Name:
Chromobox homolog 4
NCBI Gene Id:
Alias Symbols:
PC2; NBP16
Sample Type Confirmation:

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CBX4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
E3 SUMO-protein ligase CBX4
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-CBX4 antibody: synthetic peptide directed towards the N terminal of human CBX4
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
CBX4 antibody - N-terminal region (ARP30002_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Species Reactivity:
Bovine, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-CBX4 antibody
- ARP30002_P050
Peptide Sequence:
Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Blocking Peptide:
For anti-CBX4 antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Target Reference:
Kagey,M.H., et al., (2003) Cell 113 (1), 127-137
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CBX4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for CBX4 antibody (ARP30002)

Product page for CBX4 antibody (ARP30002)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog cbx4 antibody; Xenopus laevis cbx4 antibody Q91647 85%
African clawed frog cbx4-a antibody; Xenopus laevis cbx4-a antibody B7ZRU1 85%
Bovine CBX4 antibody; Bos taurus CBX4 antibody Q52T69 100%
Bovine CBX4 antibody; Bos taurus CBX4 antibody F1N7W4 100%
Bovine CBX4 antibody; Bos taurus CBX4 antibody A1L503 100%
Chicken CBX4 antibody; Gallus gallus CBX4 antibody O93482 92%
Chicken CBX4 antibody; Gallus gallus CBX4 antibody F1NEW9 92%
Dog CBX4 antibody; Canis familiaris CBX4 antibody F1PWF0 100%
Giant panda CBX4 antibody; Ailuropoda melanoleuca CBX4 antibody G1M9A5 100%
Gray short-tailed opossum CBX4 antibody; Monodelphis domestica CBX4 antibody F6YF57 100%
Green anole CBX4 antibody; Anolis carolinensis CBX4 antibody G1KRZ6 84%
Guinea pig CBX4 antibody; Cavia porcellus CBX4 antibody H0W277 100%
Human CBX4 antibody; Homo sapiens CBX4 antibody O00257 100%
Human CBX4 antibody; Homo sapiens CBX4 antibody O00257-3 100%
Human CBX4 antibody; Homo sapiens CBX4 antibody B1PJR7 100%
Little brown bat CBX4 antibody; Myotis lucifugus CBX4 antibody G1P412 92%
Lowland gorilla CBX4 antibody; Gorilla gorilla gorilla CBX4 antibody G3RQW2 100%
Lowland gorilla CBX4 antibody; Gorilla gorilla gorilla CBX4 antibody G3R1J8 100%
Mouse CBX4 antibody; Mus musculus CBX4 antibody O55187 100%
Mouse CBX4 antibody; Mus musculus CBX4 antibody O55187-2 100%
Mouse Cbx4 antibody; Mus musculus Cbx4 antibody Q05BI5 100%
Mouse Cbx4 antibody; Mus musculus Cbx4 antibody A2ABG5 100%
Northern white-cheeked gibbon CBX4 antibody; Nomascus leucogenys CBX4 antibody G1QH16 100%
Pig CBX4 antibody; Sus scrofa CBX4 antibody F1RZ78 100%
Pig CBX4 antibody; Sus scrofa CBX4 antibody F1RZ76 100%
Rabbit CBX4 antibody; Oryctolagus cuniculus CBX4 antibody G1TA61 100%
Rhesus macaque LOC717683 antibody; Macaca mulatta LOC717683 antibody F7FLH5 100%
Rhesus macaque LOC717683 antibody; Macaca mulatta LOC717683 antibody F7FLH0 100%
Small-eared galago CBX4 antibody; Otolemur garnettii CBX4 antibody H0XHY5 100%
White-tufted-ear marmoset LOC100409013 antibody; Callithrix jacchus LOC100409013 antibody F7G8B0 100%
White-tufted-ear marmoset LOC100409013 antibody; Callithrix jacchus LOC100409013 antibody F7FWD6 100%
Zebra finch CBX4 antibody; Taeniopygia guttata CBX4 antibody H0YY69 92%

Product Protocols: CBX4 antibody tested with Human Jurkat Cells (ARP30002_P050)

Aviva Systems Biology is the original manufacturer of this CBX4 antibody (ARP30002_P050)

Click here to view the CBX4 antibody Western Blot Protocol

Product Datasheet Link: CBX4 antibody (ARP30002_P050)

WB Suggested Anti-CBX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:

Description of Target: The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CBX4 antibody (ARP30002_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: CBX4 antibody tested by IHC with human kidney (ARP30002)

Aviva Systems Biology is the original manufacturer of this CBX4 antibody.

Click here to view the CBX4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CBX4 antibody (ARP30002)

IHC Information:

Rabbit Anti-CBX 4 Antibody
Catalog Number: ARP30002
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question