- Description of Target:
- Zinc Finger Protein 341 is a new candidate transcription factor.
- Gene Symbol:
- ZNF341
- Official Gene Full Name:
- Zinc finger protein 341
- Tissue Tool:
- Find tissues and cell lines supported to express ZNF341.
- Protein Accession# :
- NP_116208
- Nucleotide Accession#:
- NM_032819
- Swissprot Id:
- Q9BYN7
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 847
- Molecular Weight:
- 92kDa
- Application:
- WB
- Partner Proteins:
- PRPF40A
- Immunogen:
- The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the N terminal of human ZNF341
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- ZNF341 antibody - N-terminal region (ARP30013_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Horse: 100%; Human: 100%; Pig: 100%; Dog: 92%; Rabbit: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-ZNF341 antibody
- ARP30013_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: EGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCK
- Blocking Peptide:
- For anti-ZNF341 antibody is Catalog # AAP30013 (Previous Catalog # AAPH00113)
- Key Reference:
- Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-ZNF341 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: ZNF341 antibody tested with Human Hepg2 Cells (ARP30013_T100)
Aviva Systems Biology is the original manufacturer of this ZNF341 antibody (ARP30013_T100)
Click here to view the ZNF341 antibody Western Blot Protocol
Product Datasheet Link: ZNF341 antibody (ARP30013_T100)
WB Suggested Anti-ZNF341 Antibody Titration: 2.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2
Western Blot image: 
Description of Target: Zinc Finger Protein 341 is a new candidate transcription factor.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s ZNF341 antibody (ARP30013_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
