ZNF341 antibody - middle region (ARP30014_P050)

Catalog#: ARP30014_P050

• Size: 50ug

Human HepG2

Human Intestine

• Description of Target: The ZNF341 gene is located on chromosome 20.
• Gene Symbol: ZNF341
• Official Gene Full Name: Zinc finger protein 341
• Protein Accession#: NP_116208
• Nucleotide Accession#: NM_032819
• Swissprot Id: Q9BYN7
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 847
• Molecular Weight: 92kDa
• Application: WB, IHC
• Partner Proteins: MED31, MED31
• Immunogen: The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Bovine: 85%; Dog: 85%; Rabbit: 85%
• Peptide Sequence: Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
• Blocking Peptide: For anti-ZNF341 antibody is Catalog # AAP30014 (Previous Catalog # AAPH00114)
• Key Reference: Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-ZNF341 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: ZNF341 antibody tested with Human Hepg2 Cells (ARP30014_P050)

Aviva Systems Biology is the original manufacturer of this ZNF341 antibody (ARP30014_P050)

Click here to view the ZNF341 antibody Western Blot Protocol

Product Datasheet Link: ZNF341 antibody (ARP30014_P050)

WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: The ZNF341 gene is located on chromosome 20.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ZNF341 antibody (ARP30014_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: ZNF341 antibody tested by IHC with human intestine (ARP30014)

Aviva Systems Biology is the original manufacturer of this ZNF341 antibody.

Click here to view the ZNF341 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ZNF341 antibody (ARP30014)

IHC Information:

Rabbit Anti-ZNF341 Antibody
Catalog Number: ARP30014
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: