SUPT3H antibody - N-terminal region (ARP30038_T100)

Catalog#: ARP30038_T100

• Size: 100ug

Human HepG2

Human Liver

• Description of Target: SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
• Gene Symbol: SUPT3H
• Official Gene Full Name: Suppressor of Ty 3 homolog (S. cerevisiae)
• Alias Symbols: SPT3; SPT3L
• Protein Accession#: NP_003590
• Nucleotide Accession#: NM_003599
• Swissprot Id: O75486
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 317
• Molecular Weight: 36kDa
• Application: WB, IHC
• Partner Proteins: NCOA1, YAP1, NCOA1, VGLL1
• Immunogen: The immunogen for anti-SUPT3H antibody: synthetic peptide directed towards the N terminal of human SUPT3H
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Pig: 100%; Chicken: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 85%; Rabbit: 85%; African clawed frog: 83%
• Peptide Sequence: Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
• Blocking Peptide: For anti-SUPT3H antibody is Catalog # AAP30038 (Previous Catalog # AAPH00214)
• Key Reference: Yu,J., et al., (1998) Genomics 53 (1), 90-96
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-SUPT3H antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SUPT3H antibody tested with Human Hepg2 Cells (ARP30038_T100)

Aviva Systems Biology is the original manufacturer of this SUPT3H antibody (ARP30038_T100)

Click here to view the SUPT3H antibody Western Blot Protocol

Product Datasheet Link: SUPT3H antibody (ARP30038_T100)

WB Suggested Anti-SUPT3H Antibody Titration: 0.4ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:


Description of Target: SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SUPT3H antibody (ARP30038_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: SUPT3H antibody tested by IHC with human liver (ARP30038)

Aviva Systems Biology is the original manufacturer of this SUPT3H antibody.

Click here to view the SUPT3H antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SUPT3H antibody (ARP30038)

IHC Information:

Rabbit Anti-SUPT3H Antibody
Catalog Number: ARP30038
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: