Dnmt1 antibody - N-terminal region (ARP37033_P050)

Catalog#: ARP37033_P050

• Size: 50ug

Mouse Lung

Mouse ES

• Description of Target: Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
• Gene Symbol: Dnmt1
• Official Gene Full Name: DNA methyltransferase (cytosine-5) 1
• Alias Symbols: Cxxc9; Dnmt; Dnmt1o; MTase; Met-1; Met1; MommeD2; MCMT; m.MmuI
• Protein Accession#: NP_034196
• Nucleotide Accession#: NM_010066
• Swissprot Id: P13864
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 1619
• Molecular Weight: 183kDa
• Application: WB
• Partner Proteins: HDAC1
• Immunogen: The immunogen for anti-Dnmt1 antibody: synthetic peptide directed towards the N terminal of mouse Dnmt1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
• Blocking Peptide: For anti-Dnmt1 antibody is Catalog # AAP37033 (Previous Catalog # AAPP09231)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-Dnmt1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: Dnmt1 antibody tested with Human Mouse Lung Tissue (ARP37033_P050)

Aviva Systems Biology is the original manufacturer of this Dnmt1 antibody (ARP37033_P050)

Click here to view the Dnmt1 antibody Western Blot Protocol

Product Datasheet Link: Dnmt1 antibody (ARP37033_P050)

WB Suggested Anti-Dnmt1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Lung

Western Blot image:


Description of Target: Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s Dnmt1 antibody (ARP37033_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review:Dnmt1 antibody-N-terminal region (ARP37033_P050) in WT mouse ES lysate and DNMT1 KO mouse ES lysate using Western blot

Product Page for Dnmt1 antibody-N-terminal region (ARP37033_P050)

Researcher:Austin J. Cooney, Baylor College of Medicine
Application:Western blotting
Species+tissue/cell type: Lane 1: 15ug WT mouse ES lysate Lane 2: 15ug DNMT1 KO mouse ES lysate
Primary antibody dilution:1:1000
Secondary antibody:Goat anti-rabbit-HRP
Secondary antibody dilution:1:2500