website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

NLK antibody - middle region (ARP56863_P050)

Description of Target:
NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
Gene Symbol:
NLK
Official Gene Full Name:
Nemo-like kinase
NCBI Gene Id:
51701
Alias Symbols:
DKFZp761G1211; FLJ21033
Tissue Tool:
Find tissues and cell lines supported to express NLK.
Protein Accession #:
NP_057315
Nucleotide Accession#:
NM_016231
Swissprot Id:
Q9UBE8
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Serine/threonine-protein kinase NLK
Protein Size (# AA):
527
Molecular Weight:
58kDa
Application:
WB
Partner Proteins:
ATXN1, CREBBP, HIPK2, LEF1, MYB, NLK, STAT3, CTNNB1, CUL1, FBXW4, FBXW5, LEF1, MYB, SKP2, TCF7L2, UBC
Immunogen:
The immunogen for anti-NLK antibody: synthetic peptide directed towards the middle region of human NLK
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
NLK antibody - middle region (ARP56863_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 93%
Species Reactivity:
Rat, Bovine, Pig, Horse, Mouse, Guinea pig, Human, Zebrafish, Dog, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-NLK antibody
- ARP56863_P050
Peptide Sequence:
Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
Blocking Peptide:
For anti-NLK antibody is Catalog # AAP56863 (Previous Catalog # AAPP44229)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-NLK antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question