website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

NLK antibody - middle region (ARP56863_P050)

Description of Target:
NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
Gene Symbol:
Official Gene Full Name:
Nemo-like kinase
NCBI Gene Id:
Alias Symbols:
DKFZp761G1211; FLJ21033
Tissue Tool:
Find tissues and cell lines supported to express NLK.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Serine/threonine-protein kinase NLK
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-NLK antibody: synthetic peptide directed towards the middle region of human NLK
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
NLK antibody - middle region (ARP56863_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 93%
Species Reactivity:
Rat, Bovine, Pig, Horse, Mouse, Guinea pig, Human, Zebrafish, Dog, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-NLK antibody
- ARP56863_P050
Peptide Sequence:
Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
Blocking Peptide:
For anti-NLK antibody is Catalog # AAP56863 (Previous Catalog # AAPP44229)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-NLK antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for NLK antibody (ARP56863)

Product page for NLK antibody (ARP56863)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog nlk antibody; Xenopus laevis nlk antibody Q6NU06 92%
African clawed frog nlk antibody; Xenopus laevis nlk antibody D2KW22 92%
African elephant LOC100668196 antibody; Loxodonta africana LOC100668196 antibody G3TC07 100%
Bovine NLK antibody; Bos taurus NLK antibody E1BMN8 100%
Chicken NLK antibody; Gallus gallus NLK antibody F1N862 92%
Common turkey NLK antibody; Meleagris gallopavo NLK antibody G1N8T2 92%
Dog NLK antibody; Canis familiaris NLK antibody E2QWQ2 92%
Duckbill platypus NLK antibody; Ornithorhynchus anatinus NLK antibody F7CTH5 92%
Giant panda NLK antibody; Ailuropoda melanoleuca NLK antibody G1LEU7 92%
Gray short-tailed opossum NLK antibody; Monodelphis domestica NLK antibody F7C4H4 92%
Gray short-tailed opossum NLK antibody; Monodelphis domestica NLK antibody F6RE45 92%
Guinea pig NLK antibody; Cavia porcellus NLK antibody H0UVF3 100%
Horse NLK antibody; Equus caballus NLK antibody F6Q5M6 100%
Human NLK antibody; Homo sapiens NLK antibody Q9UBE8 100%
Human NLK antibody; Homo sapiens NLK antibody H0YD75 100%
Japanese pufferfish nlk antibody; Takifugu rubripes nlk antibody Q9I863 92%
Little brown bat NLK antibody; Myotis lucifugus NLK antibody G1PBZ9 100%
Lowland gorilla NLK antibody; Gorilla gorilla gorilla NLK antibody G3S5N7 100%
Lowland gorilla NLK antibody; Gorilla gorilla gorilla NLK antibody G3R4R6 100%
Mouse NLK antibody; Mus musculus NLK antibody O54949 100%
Mouse Nlk antibody; Mus musculus Nlk antibody G3X8T1 100%
Mouse Nlk antibody; Mus musculus Nlk antibody F6QKY6 100%
Northern white-cheeked gibbon NLK antibody; Nomascus leucogenys NLK antibody G1QMQ8 100%
Pig LOC100623881 antibody; Sus scrofa LOC100623881 antibody F1RJ28 100%
Rabbit NLK antibody; Oryctolagus cuniculus NLK antibody G1STQ5 92%
Rat NLK antibody; Rattus norvegicus NLK antibody D3ZSZ3 100%
Rat RGD1561440 antibody; Rattus norvegicus RGD1561440 antibody D4A2E1 100%
Red deer NLK antibody; Cervus elaphus NLK antibody A6YLM9 100%
Rhesus macaque Mmu.9543 antibody; Macaca mulatta Mmu.9543 antibody F6YC03 100%
Rhesus macaque NLK antibody; Macaca mulatta NLK antibody Q4G3Z1 100%
Small-eared galago NLK antibody; Otolemur garnettii NLK antibody H0WMJ7 100%
Tasmanian devil NLK antibody; Sarcophilus harrisii NLK antibody G3WDU3 100%
Three-spined stickleback NLK antibody; Gasterosteus aculeatus NLK antibody G3NMN9 85%
Western clawed frog nlk antibody; Xenopus tropicalis nlk antibody B0JZD9 92%
White-tufted-ear marmoset NLK antibody; Callithrix jacchus NLK antibody F7IFD7 100%
Zebra finch NLK antibody; Taeniopygia guttata NLK antibody H0ZEE5 92%
Zebrafish nlk2 antibody; Danio rerio nlk2 antibody F1QVU4 92%
Zebrafish nlk2 antibody; Danio rerio nlk2 antibody E7F1L8 92%
Zebrafish nlk2 antibody; Danio rerio nlk2 antibody B3IWJ8 92%
Zebrafish nlk2 antibody; Danio rerio nlk2 antibody A9ZMG5 92%

Product Protocols: NLK antibody tested with Human 293T Cells (ARP56863_P050)

Aviva Systems Biology is the original manufacturer of this NLK antibody (ARP56863_P050)

Click here to view the NLK antibody Western Blot Protocol

Product Datasheet Link: NLK antibody (ARP56863_P050)

WB Suggested Anti-NLK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T

Western Blot image:

Description of Target: NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s NLK antibody (ARP56863_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question