website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

NLK antibody - middle region (ARP56863_P050)

Description of Target:
NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
Gene Symbol:
NLK
Official Gene Full Name:
Nemo-like kinase
NCBI Gene Id:
51701
Alias Symbols:
DKFZp761G1211; FLJ21033
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NLK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NLK.
Swissprot Id:
Q9UBE8
Protein Accession #:
NP_057315
Nucleotide Accession #:
NM_016231
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Serine/threonine-protein kinase NLK
Protein Size (# AA):
527
Molecular Weight:
58kDa
Application:
WB
Protein Interactions:
KRTAP5-6; KRTAP10-3; KRTAP4-2; QRICH1; ZHX3; KRTAP5-9; GRN; TP53; MDM2; STAT5A; LEF1; CNOT2; SMAD4; KPNB1; BACH1; TNKS1BP1; FAM222A; C2orf44; CEP97; RNF219; FAM222B; CNOT11; NLK; PASK; SHANK2; UBAP2L; CCP110; TRPS1; TLE3; SKI; RANGAP1; RANBP2; PKM; CNOT3;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-NLK (ARP56863_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 93%
Species Reactivity:
Rat, Bovine, Pig, Horse, Mouse, Guinea pig, Human, Zebrafish, Dog, Rabbit
Datasheets / Downloads:
Printable datasheet for anti-NLK (ARP56863_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
Blocking Peptide:
For anti-NLK (ARP56863_P050) antibody is Catalog # AAP56863 (Previous Catalog # AAPP44229)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: NLK antibody tested with Human 293T Cells (ARP56863_P050)

Aviva Systems Biology is the original manufacturer of this NLK antibody (ARP56863_P050)

Click here to view the NLK antibody Western Blot Protocol

Product Datasheet Link: NLK antibody (ARP56863_P050)

WB Suggested Anti-NLK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T

Western Blot image:


Description of Target: NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s NLK antibody (ARP56863_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question