- Description of Target:
- NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
- Gene Symbol:
- NLK
- Official Gene Full Name:
- Nemo-like kinase
- Alias Symbols:
- DKFZp761G1211; FLJ21033
- Tissue Tool:
- Find tissues and cell lines supported to express NLK.

- Protein Accession# :
- NP_057315
- Nucleotide Accession#:
- NM_016231
- Swissprot Id:
- Q9UBE8
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 527
- Molecular Weight:
- 58kDa
- Application:
- WB
- Partner Proteins:
- ATXN1, CREBBP, HIPK2, LEF1, MYB, NLK, STAT3, CTNNB1, CUL1, FBXW4, FBXW5, LEF1, MYB, SKP2, TCF7L2, UBC
- Immunogen:
- The immunogen for anti-NLK antibody: synthetic peptide directed towards the middle region of human NLK
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- NLK antibody - middle region (ARP56863_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; African clawed frog: 92%; Chicken: 92%; Dog: 92%; Rabbit: 92%; Zebrafish: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-NLK antibody
- ARP56863_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
- Blocking Peptide:
- For anti-NLK antibody is Catalog # AAP56863 (Previous Catalog # AAPP44229)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-NLK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: NLK antibody tested with Human 293T Cells (ARP56863_P050)
Aviva Systems Biology is the original manufacturer of this NLK antibody (ARP56863_P050)
Click here to view the NLK antibody Western Blot Protocol
Product Datasheet Link: NLK antibody (ARP56863_P050)
WB Suggested Anti-NLK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T
Western Blot image: 
Description of Target: NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s NLK antibody (ARP56863_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


