website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

NEGR1 antibody - N-terminal region (ARP55701_P050)

Description of Target:
NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.
Gene Symbol:
Official Gene Full Name:
Neuronal growth regulator 1
NCBI Gene Id:
Alias Symbols:
DMML2433; IGLON4; KILON; MGC46680; Ntra
Tissue Tool:
Find tissues and cell lines supported to express NEGR1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Neuronal growth regulator 1
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
NEGR1 antibody - N-terminal region (ARP55701_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Human, Pig, Rat, Dog, Horse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-NEGR1 antibody
- ARP55701_P050
Peptide Sequence:
Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
Blocking Peptide:
For anti-NEGR1 antibody is Catalog # AAP55701 (Previous Catalog # AAPP44438)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for NEGR1 antibody (ARP55701)

Product page for NEGR1 antibody (ARP55701)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Gray short-tailed opossum NEGR1 antibody; Monodelphis domestica NEGR1 antibody F6UA82 100%
Gray short-tailed opossum NEGR1 antibody; Monodelphis domestica NEGR1 antibody F6UA66 100%
Guinea pig NEGR1 antibody; Cavia porcellus NEGR1 antibody H0W7N7 100%
Guinea pig NEGR1 antibody; Cavia porcellus NEGR1 antibody H0V3A6 100%
Horse NEGR1 antibody; Equus caballus NEGR1 antibody F6ZLB0 100%
Human NEGR1 antibody; Homo sapiens NEGR1 antibody Q7Z3B1 100%
Human NEGR1 antibody; Homo sapiens NEGR1 antibody B4DI94 100%
Little brown bat NEGR1 antibody; Myotis lucifugus NEGR1 antibody G1PQA7 100%
Lowland gorilla NEGR1 antibody; Gorilla gorilla gorilla NEGR1 antibody G3QWV5 100%
Mouse NEGR1 antibody; Mus musculus NEGR1 antibody Q80Z24 100%
Mouse Negr1 antibody; Mus musculus Negr1 antibody D3Z4T6 100%
Mouse Negr1 antibody; Mus musculus Negr1 antibody A0A4W9 100%
Northern white-cheeked gibbon NEGR1 antibody; Nomascus leucogenys NEGR1 antibody G1RE65 100%
Pig NEGR1 antibody; Sus scrofa NEGR1 antibody B9TRX1 100%
Rabbit NEGR1 antibody; Oryctolagus cuniculus NEGR1 antibody G1SUV6 100%
Rat NEGR1 antibody; Rattus norvegicus NEGR1 antibody Q9Z0J8 100%
Rhesus macaque NEGR1 antibody; Macaca mulatta NEGR1 antibody F7HQB1 100%
Small-eared galago NEGR1 antibody; Otolemur garnettii NEGR1 antibody H0WSZ9 100%
Sumatran orangutan NEGR1 antibody; Pongo abelii NEGR1 antibody Q5R412 100%
Tasmanian devil NEGR1 antibody; Sarcophilus harrisii NEGR1 antibody G3WE21 100%
White-tufted-ear marmoset NEGR1 antibody; Callithrix jacchus NEGR1 antibody F7FLZ5 100%

Product Protocols: NEGR1 antibody tested with Human Hepg2 Cells (ARP55701_P050)

Aviva Systems Biology is the original manufacturer of this NEGR1 antibody (ARP55701_P050)

Click here to view the NEGR1 antibody Western Blot Protocol

Product Datasheet Link: NEGR1 antibody (ARP55701_P050)

WB Suggested Anti-NEGR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:

Description of Target: NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s NEGR1 antibody (ARP55701_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question